diff options
Diffstat (limited to 'vendor/golang.org/x/text/internal')
38 files changed, 0 insertions, 11744 deletions
diff --git a/vendor/golang.org/x/text/internal/format/LICENSE b/vendor/golang.org/x/text/internal/format/LICENSE deleted file mode 100644 index 6a66aea5..00000000 --- a/vendor/golang.org/x/text/internal/format/LICENSE +++ /dev/null @@ -1,27 +0,0 @@ -Copyright (c) 2009 The Go Authors. All rights reserved. - -Redistribution and use in source and binary forms, with or without -modification, are permitted provided that the following conditions are -met: - - * Redistributions of source code must retain the above copyright -notice, this list of conditions and the following disclaimer. - * Redistributions in binary form must reproduce the above -copyright notice, this list of conditions and the following disclaimer -in the documentation and/or other materials provided with the -distribution. - * Neither the name of Google Inc. nor the names of its -contributors may be used to endorse or promote products derived from -this software without specific prior written permission. - -THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS -"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT -LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR -A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT -OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, -SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT -LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, -DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY -THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT -(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE -OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/golang.org/x/text/internal/format/format.go b/vendor/golang.org/x/text/internal/format/format.go deleted file mode 100644 index ee1c57a3..00000000 --- a/vendor/golang.org/x/text/internal/format/format.go +++ /dev/null @@ -1,41 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package format contains types for defining language-specific formatting of -// values. -// -// This package is internal now, but will eventually be exposed after the API -// settles. -package format // import "golang.org/x/text/internal/format" - -import ( - "fmt" - - "golang.org/x/text/language" -) - -// State represents the printer state passed to custom formatters. It provides -// access to the fmt.State interface and the sentence and language-related -// context. -type State interface { - fmt.State - - // Language reports the requested language in which to render a message. - Language() language.Tag - - // TODO: consider this and removing rune from the Format method in the - // Formatter interface. - // - // Verb returns the format variant to render, analogous to the types used - // in fmt. Use 'v' for the default or only variant. - // Verb() rune - - // TODO: more info: - // - sentence context such as linguistic features passed by the translator. -} - -// Formatter is analogous to fmt.Formatter. -type Formatter interface { - Format(state State, verb rune) -} diff --git a/vendor/golang.org/x/text/internal/format/parser.go b/vendor/golang.org/x/text/internal/format/parser.go deleted file mode 100644 index 855aed71..00000000 --- a/vendor/golang.org/x/text/internal/format/parser.go +++ /dev/null @@ -1,358 +0,0 @@ -// Copyright 2017 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package format - -import ( - "reflect" - "unicode/utf8" -) - -// A Parser parses a format string. The result from the parse are set in the -// struct fields. -type Parser struct { - Verb rune - - WidthPresent bool - PrecPresent bool - Minus bool - Plus bool - Sharp bool - Space bool - Zero bool - - // For the formats %+v %#v, we set the plusV/sharpV flags - // and clear the plus/sharp flags since %+v and %#v are in effect - // different, flagless formats set at the top level. - PlusV bool - SharpV bool - - HasIndex bool - - Width int - Prec int // precision - - // retain arguments across calls. - Args []interface{} - // retain current argument number across calls - ArgNum int - - // reordered records whether the format string used argument reordering. - Reordered bool - // goodArgNum records whether the most recent reordering directive was valid. - goodArgNum bool - - // position info - format string - startPos int - endPos int - Status Status -} - -// Reset initializes a parser to scan format strings for the given args. -func (p *Parser) Reset(args []interface{}) { - p.Args = args - p.ArgNum = 0 - p.startPos = 0 - p.Reordered = false -} - -// Text returns the part of the format string that was parsed by the last call -// to Scan. It returns the original substitution clause if the current scan -// parsed a substitution. -func (p *Parser) Text() string { return p.format[p.startPos:p.endPos] } - -// SetFormat sets a new format string to parse. It does not reset the argument -// count. -func (p *Parser) SetFormat(format string) { - p.format = format - p.startPos = 0 - p.endPos = 0 -} - -// Status indicates the result type of a call to Scan. -type Status int - -const ( - StatusText Status = iota - StatusSubstitution - StatusBadWidthSubstitution - StatusBadPrecSubstitution - StatusNoVerb - StatusBadArgNum - StatusMissingArg -) - -// ClearFlags reset the parser to default behavior. -func (p *Parser) ClearFlags() { - p.WidthPresent = false - p.PrecPresent = false - p.Minus = false - p.Plus = false - p.Sharp = false - p.Space = false - p.Zero = false - - p.PlusV = false - p.SharpV = false - - p.HasIndex = false -} - -// Scan scans the next part of the format string and sets the status to -// indicate whether it scanned a string literal, substitution or error. -func (p *Parser) Scan() bool { - p.Status = StatusText - format := p.format - end := len(format) - if p.endPos >= end { - return false - } - afterIndex := false // previous item in format was an index like [3]. - - p.startPos = p.endPos - p.goodArgNum = true - i := p.startPos - for i < end && format[i] != '%' { - i++ - } - if i > p.startPos { - p.endPos = i - return true - } - // Process one verb - i++ - - p.Status = StatusSubstitution - - // Do we have flags? - p.ClearFlags() - -simpleFormat: - for ; i < end; i++ { - c := p.format[i] - switch c { - case '#': - p.Sharp = true - case '0': - p.Zero = !p.Minus // Only allow zero padding to the left. - case '+': - p.Plus = true - case '-': - p.Minus = true - p.Zero = false // Do not pad with zeros to the right. - case ' ': - p.Space = true - default: - // Fast path for common case of ascii lower case simple verbs - // without precision or width or argument indices. - if 'a' <= c && c <= 'z' && p.ArgNum < len(p.Args) { - if c == 'v' { - // Go syntax - p.SharpV = p.Sharp - p.Sharp = false - // Struct-field syntax - p.PlusV = p.Plus - p.Plus = false - } - p.Verb = rune(c) - p.ArgNum++ - p.endPos = i + 1 - return true - } - // Format is more complex than simple flags and a verb or is malformed. - break simpleFormat - } - } - - // Do we have an explicit argument index? - i, afterIndex = p.updateArgNumber(format, i) - - // Do we have width? - if i < end && format[i] == '*' { - i++ - p.Width, p.WidthPresent = p.intFromArg() - - if !p.WidthPresent { - p.Status = StatusBadWidthSubstitution - } - - // We have a negative width, so take its value and ensure - // that the minus flag is set - if p.Width < 0 { - p.Width = -p.Width - p.Minus = true - p.Zero = false // Do not pad with zeros to the right. - } - afterIndex = false - } else { - p.Width, p.WidthPresent, i = parsenum(format, i, end) - if afterIndex && p.WidthPresent { // "%[3]2d" - p.goodArgNum = false - } - } - - // Do we have precision? - if i+1 < end && format[i] == '.' { - i++ - if afterIndex { // "%[3].2d" - p.goodArgNum = false - } - i, afterIndex = p.updateArgNumber(format, i) - if i < end && format[i] == '*' { - i++ - p.Prec, p.PrecPresent = p.intFromArg() - // Negative precision arguments don't make sense - if p.Prec < 0 { - p.Prec = 0 - p.PrecPresent = false - } - if !p.PrecPresent { - p.Status = StatusBadPrecSubstitution - } - afterIndex = false - } else { - p.Prec, p.PrecPresent, i = parsenum(format, i, end) - if !p.PrecPresent { - p.Prec = 0 - p.PrecPresent = true - } - } - } - - if !afterIndex { - i, afterIndex = p.updateArgNumber(format, i) - } - p.HasIndex = afterIndex - - if i >= end { - p.endPos = i - p.Status = StatusNoVerb - return true - } - - verb, w := utf8.DecodeRuneInString(format[i:]) - p.endPos = i + w - p.Verb = verb - - switch { - case verb == '%': // Percent does not absorb operands and ignores f.wid and f.prec. - p.startPos = p.endPos - 1 - p.Status = StatusText - case !p.goodArgNum: - p.Status = StatusBadArgNum - case p.ArgNum >= len(p.Args): // No argument left over to print for the current verb. - p.Status = StatusMissingArg - p.ArgNum++ - case verb == 'v': - // Go syntax - p.SharpV = p.Sharp - p.Sharp = false - // Struct-field syntax - p.PlusV = p.Plus - p.Plus = false - fallthrough - default: - p.ArgNum++ - } - return true -} - -// intFromArg gets the ArgNumth element of Args. On return, isInt reports -// whether the argument has integer type. -func (p *Parser) intFromArg() (num int, isInt bool) { - if p.ArgNum < len(p.Args) { - arg := p.Args[p.ArgNum] - num, isInt = arg.(int) // Almost always OK. - if !isInt { - // Work harder. - switch v := reflect.ValueOf(arg); v.Kind() { - case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: - n := v.Int() - if int64(int(n)) == n { - num = int(n) - isInt = true - } - case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: - n := v.Uint() - if int64(n) >= 0 && uint64(int(n)) == n { - num = int(n) - isInt = true - } - default: - // Already 0, false. - } - } - p.ArgNum++ - if tooLarge(num) { - num = 0 - isInt = false - } - } - return -} - -// parseArgNumber returns the value of the bracketed number, minus 1 -// (explicit argument numbers are one-indexed but we want zero-indexed). -// The opening bracket is known to be present at format[0]. -// The returned values are the index, the number of bytes to consume -// up to the closing paren, if present, and whether the number parsed -// ok. The bytes to consume will be 1 if no closing paren is present. -func parseArgNumber(format string) (index int, wid int, ok bool) { - // There must be at least 3 bytes: [n]. - if len(format) < 3 { - return 0, 1, false - } - - // Find closing bracket. - for i := 1; i < len(format); i++ { - if format[i] == ']' { - width, ok, newi := parsenum(format, 1, i) - if !ok || newi != i { - return 0, i + 1, false - } - return width - 1, i + 1, true // arg numbers are one-indexed and skip paren. - } - } - return 0, 1, false -} - -// updateArgNumber returns the next argument to evaluate, which is either the value of the passed-in -// argNum or the value of the bracketed integer that begins format[i:]. It also returns -// the new value of i, that is, the index of the next byte of the format to process. -func (p *Parser) updateArgNumber(format string, i int) (newi int, found bool) { - if len(format) <= i || format[i] != '[' { - return i, false - } - p.Reordered = true - index, wid, ok := parseArgNumber(format[i:]) - if ok && 0 <= index && index < len(p.Args) { - p.ArgNum = index - return i + wid, true - } - p.goodArgNum = false - return i + wid, ok -} - -// tooLarge reports whether the magnitude of the integer is -// too large to be used as a formatting width or precision. -func tooLarge(x int) bool { - const max int = 1e6 - return x > max || x < -max -} - -// parsenum converts ASCII to integer. num is 0 (and isnum is false) if no number present. -func parsenum(s string, start, end int) (num int, isnum bool, newi int) { - if start >= end { - return 0, false, end - } - for newi = start; newi < end && '0' <= s[newi] && s[newi] <= '9'; newi++ { - if tooLarge(num) { - return 0, false, end // Overflow; crazy long number most likely. - } - num = num*10 + int(s[newi]-'0') - isnum = true - } - return -} diff --git a/vendor/golang.org/x/text/internal/gen/LICENSE b/vendor/golang.org/x/text/internal/gen/LICENSE deleted file mode 100644 index 6a66aea5..00000000 --- a/vendor/golang.org/x/text/internal/gen/LICENSE +++ /dev/null @@ -1,27 +0,0 @@ -Copyright (c) 2009 The Go Authors. All rights reserved. - -Redistribution and use in source and binary forms, with or without -modification, are permitted provided that the following conditions are -met: - - * Redistributions of source code must retain the above copyright -notice, this list of conditions and the following disclaimer. - * Redistributions in binary form must reproduce the above -copyright notice, this list of conditions and the following disclaimer -in the documentation and/or other materials provided with the -distribution. - * Neither the name of Google Inc. nor the names of its -contributors may be used to endorse or promote products derived from -this software without specific prior written permission. - -THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS -"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT -LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR -A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT -OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, -SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT -LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, -DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY -THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT -(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE -OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/golang.org/x/text/internal/gen/bitfield/bitfield.go b/vendor/golang.org/x/text/internal/gen/bitfield/bitfield.go deleted file mode 100644 index a8d0a48d..00000000 --- a/vendor/golang.org/x/text/internal/gen/bitfield/bitfield.go +++ /dev/null @@ -1,226 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package bitfield converts annotated structs into integer values. -// -// Any field that is marked with a bitfield tag is compacted. The tag value has -// two parts. The part before the comma determines the method name for a -// generated type. If left blank the name of the field is used. -// The part after the comma determines the number of bits to use for the -// representation. -package bitfield - -import ( - "bytes" - "fmt" - "io" - "reflect" - "strconv" - "strings" -) - -// Config determines settings for packing and generation. If a Config is used, -// the same Config should be used for packing and generation. -type Config struct { - // NumBits fixes the maximum allowed bits for the integer representation. - // If NumBits is not 8, 16, 32, or 64, the actual underlying integer size - // will be the next largest available. - NumBits uint - - // If Package is set, code generation will write a package clause. - Package string - - // TypeName is the name for the generated type. By default it is the name - // of the type of the value passed to Gen. - TypeName string -} - -var nullConfig = &Config{} - -// Pack packs annotated bit ranges of struct x in an integer. -// -// Only fields that have a "bitfield" tag are compacted. -func Pack(x interface{}, c *Config) (packed uint64, err error) { - packed, _, err = pack(x, c) - return -} - -func pack(x interface{}, c *Config) (packed uint64, nBit uint, err error) { - if c == nil { - c = nullConfig - } - nBits := c.NumBits - v := reflect.ValueOf(x) - v = reflect.Indirect(v) - t := v.Type() - pos := 64 - nBits - if nBits == 0 { - pos = 0 - } - for i := 0; i < v.NumField(); i++ { - v := v.Field(i) - field := t.Field(i) - f, err := parseField(field) - - if err != nil { - return 0, 0, err - } - if f.nBits == 0 { - continue - } - value := uint64(0) - switch v.Kind() { - case reflect.Bool: - if v.Bool() { - value = 1 - } - case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64: - value = v.Uint() - case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: - x := v.Int() - if x < 0 { - return 0, 0, fmt.Errorf("bitfield: negative value for field %q not allowed", field.Name) - } - value = uint64(x) - } - if value > (1<<f.nBits)-1 { - return 0, 0, fmt.Errorf("bitfield: value %#x of field %q does not fit in %d bits", value, field.Name, f.nBits) - } - shift := 64 - pos - f.nBits - if pos += f.nBits; pos > 64 { - return 0, 0, fmt.Errorf("bitfield: no more bits left for field %q", field.Name) - } - packed |= value << shift - } - if nBits == 0 { - nBits = posToBits(pos) - packed >>= (64 - nBits) - } - return packed, nBits, nil -} - -type field struct { - name string - value uint64 - nBits uint -} - -// parseField parses a tag of the form [<name>][:<nBits>][,<pos>[..<end>]] -func parseField(field reflect.StructField) (f field, err error) { - s, ok := field.Tag.Lookup("bitfield") - if !ok { - return f, nil - } - switch field.Type.Kind() { - case reflect.Bool: - case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64: - case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: - default: - return f, fmt.Errorf("bitfield: field %q is not an integer or bool type", field.Name) - } - bits := s - f.name = "" - - if i := strings.IndexByte(s, ','); i >= 0 { - bits = s[:i] - f.name = s[i+1:] - } - if bits != "" { - nBits, err := strconv.ParseUint(bits, 10, 8) - if err != nil { - return f, fmt.Errorf("bitfield: invalid bit size for field %q: %v", field.Name, err) - } - f.nBits = uint(nBits) - } - if f.nBits == 0 { - if field.Type.Kind() == reflect.Bool { - f.nBits = 1 - } else { - f.nBits = uint(field.Type.Bits()) - } - } - if f.name == "" { - f.name = field.Name - } - return f, err -} - -func posToBits(pos uint) (bits uint) { - switch { - case pos <= 8: - bits = 8 - case pos <= 16: - bits = 16 - case pos <= 32: - bits = 32 - case pos <= 64: - bits = 64 - default: - panic("unreachable") - } - return bits -} - -// Gen generates code for unpacking integers created with Pack. -func Gen(w io.Writer, x interface{}, c *Config) error { - if c == nil { - c = nullConfig - } - _, nBits, err := pack(x, c) - if err != nil { - return err - } - - t := reflect.TypeOf(x) - if t.Kind() == reflect.Ptr { - t = t.Elem() - } - if c.TypeName == "" { - c.TypeName = t.Name() - } - firstChar := []rune(c.TypeName)[0] - - buf := &bytes.Buffer{} - - print := func(w io.Writer, format string, args ...interface{}) { - if _, e := fmt.Fprintf(w, format+"\n", args...); e != nil && err == nil { - err = fmt.Errorf("bitfield: write failed: %v", err) - } - } - - pos := uint(0) - for i := 0; i < t.NumField(); i++ { - field := t.Field(i) - f, _ := parseField(field) - if f.nBits == 0 { - continue - } - shift := nBits - pos - f.nBits - pos += f.nBits - - retType := field.Type.Name() - print(buf, "\nfunc (%c %s) %s() %s {", firstChar, c.TypeName, f.name, retType) - if field.Type.Kind() == reflect.Bool { - print(buf, "\tconst bit = 1 << %d", shift) - print(buf, "\treturn %c&bit == bit", firstChar) - } else { - print(buf, "\treturn %s((%c >> %d) & %#x)", retType, firstChar, shift, (1<<f.nBits)-1) - } - print(buf, "}") - } - - if c.Package != "" { - print(w, "// Code generated by golang.org/x/text/internal/gen/bitfield. DO NOT EDIT.\n") - print(w, "package %s\n", c.Package) - } - - bits := posToBits(pos) - - print(w, "type %s uint%d", c.TypeName, bits) - - if _, err := io.Copy(w, buf); err != nil { - return fmt.Errorf("bitfield: write failed: %v", err) - } - return nil -} diff --git a/vendor/golang.org/x/text/internal/gen/code.go b/vendor/golang.org/x/text/internal/gen/code.go deleted file mode 100644 index 25aaa033..00000000 --- a/vendor/golang.org/x/text/internal/gen/code.go +++ /dev/null @@ -1,371 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package gen - -import ( - "bytes" - "encoding/gob" - "fmt" - "hash" - "hash/fnv" - "io" - "log" - "os" - "reflect" - "strings" - "unicode" - "unicode/utf8" -) - -// This file contains utilities for generating code. - -// TODO: other write methods like: -// - slices, maps, types, etc. - -// CodeWriter is a utility for writing structured code. It computes the content -// hash and size of written content. It ensures there are newlines between -// written code blocks. -type CodeWriter struct { - buf bytes.Buffer - Size int - Hash hash.Hash32 // content hash - gob *gob.Encoder - // For comments we skip the usual one-line separator if they are followed by - // a code block. - skipSep bool -} - -func (w *CodeWriter) Write(p []byte) (n int, err error) { - return w.buf.Write(p) -} - -// NewCodeWriter returns a new CodeWriter. -func NewCodeWriter() *CodeWriter { - h := fnv.New32() - return &CodeWriter{Hash: h, gob: gob.NewEncoder(h)} -} - -// WriteGoFile appends the buffer with the total size of all created structures -// and writes it as a Go file to the the given file with the given package name. -func (w *CodeWriter) WriteGoFile(filename, pkg string) { - f, err := os.Create(filename) - if err != nil { - log.Fatalf("Could not create file %s: %v", filename, err) - } - defer f.Close() - if _, err = w.WriteGo(f, pkg, ""); err != nil { - log.Fatalf("Error writing file %s: %v", filename, err) - } -} - -// WriteVersionedGoFile appends the buffer with the total size of all created -// structures and writes it as a Go file to the the given file with the given -// package name and build tags for the current Unicode version, -func (w *CodeWriter) WriteVersionedGoFile(filename, pkg string) { - tags := buildTags() - if tags != "" { - filename = insertVersion(filename, UnicodeVersion()) - } - f, err := os.Create(filename) - if err != nil { - log.Fatalf("Could not create file %s: %v", filename, err) - } - defer f.Close() - if _, err = w.WriteGo(f, pkg, tags); err != nil { - log.Fatalf("Error writing file %s: %v", filename, err) - } -} - -// WriteGo appends the buffer with the total size of all created structures and -// writes it as a Go file to the the given writer with the given package name. -func (w *CodeWriter) WriteGo(out io.Writer, pkg, tags string) (n int, err error) { - sz := w.Size - w.WriteComment("Total table size %d bytes (%dKiB); checksum: %X\n", sz, sz/1024, w.Hash.Sum32()) - defer w.buf.Reset() - return WriteGo(out, pkg, tags, w.buf.Bytes()) -} - -func (w *CodeWriter) printf(f string, x ...interface{}) { - fmt.Fprintf(w, f, x...) -} - -func (w *CodeWriter) insertSep() { - if w.skipSep { - w.skipSep = false - return - } - // Use at least two newlines to ensure a blank space between the previous - // block. WriteGoFile will remove extraneous newlines. - w.printf("\n\n") -} - -// WriteComment writes a comment block. All line starts are prefixed with "//". -// Initial empty lines are gobbled. The indentation for the first line is -// stripped from consecutive lines. -func (w *CodeWriter) WriteComment(comment string, args ...interface{}) { - s := fmt.Sprintf(comment, args...) - s = strings.Trim(s, "\n") - - // Use at least two newlines to ensure a blank space between the previous - // block. WriteGoFile will remove extraneous newlines. - w.printf("\n\n// ") - w.skipSep = true - - // strip first indent level. - sep := "\n" - for ; len(s) > 0 && (s[0] == '\t' || s[0] == ' '); s = s[1:] { - sep += s[:1] - } - - strings.NewReplacer(sep, "\n// ", "\n", "\n// ").WriteString(w, s) - - w.printf("\n") -} - -func (w *CodeWriter) writeSizeInfo(size int) { - w.printf("// Size: %d bytes\n", size) -} - -// WriteConst writes a constant of the given name and value. -func (w *CodeWriter) WriteConst(name string, x interface{}) { - w.insertSep() - v := reflect.ValueOf(x) - - switch v.Type().Kind() { - case reflect.String: - w.printf("const %s %s = ", name, typeName(x)) - w.WriteString(v.String()) - w.printf("\n") - default: - w.printf("const %s = %#v\n", name, x) - } -} - -// WriteVar writes a variable of the given name and value. -func (w *CodeWriter) WriteVar(name string, x interface{}) { - w.insertSep() - v := reflect.ValueOf(x) - oldSize := w.Size - sz := int(v.Type().Size()) - w.Size += sz - - switch v.Type().Kind() { - case reflect.String: - w.printf("var %s %s = ", name, typeName(x)) - w.WriteString(v.String()) - case reflect.Struct: - w.gob.Encode(x) - fallthrough - case reflect.Slice, reflect.Array: - w.printf("var %s = ", name) - w.writeValue(v) - w.writeSizeInfo(w.Size - oldSize) - default: - w.printf("var %s %s = ", name, typeName(x)) - w.gob.Encode(x) - w.writeValue(v) - w.writeSizeInfo(w.Size - oldSize) - } - w.printf("\n") -} - -func (w *CodeWriter) writeValue(v reflect.Value) { - x := v.Interface() - switch v.Kind() { - case reflect.String: - w.WriteString(v.String()) - case reflect.Array: - // Don't double count: callers of WriteArray count on the size being - // added, so we need to discount it here. - w.Size -= int(v.Type().Size()) - w.writeSlice(x, true) - case reflect.Slice: - w.writeSlice(x, false) - case reflect.Struct: - w.printf("%s{\n", typeName(v.Interface())) - t := v.Type() - for i := 0; i < v.NumField(); i++ { - w.printf("%s: ", t.Field(i).Name) - w.writeValue(v.Field(i)) - w.printf(",\n") - } - w.printf("}") - default: - w.printf("%#v", x) - } -} - -// WriteString writes a string literal. -func (w *CodeWriter) WriteString(s string) { - io.WriteString(w.Hash, s) // content hash - w.Size += len(s) - - const maxInline = 40 - if len(s) <= maxInline { - w.printf("%q", s) - return - } - - // We will render the string as a multi-line string. - const maxWidth = 80 - 4 - len(`"`) - len(`" +`) - - // When starting on its own line, go fmt indents line 2+ an extra level. - n, max := maxWidth, maxWidth-4 - - // As per https://golang.org/issue/18078, the compiler has trouble - // compiling the concatenation of many strings, s0 + s1 + s2 + ... + sN, - // for large N. We insert redundant, explicit parentheses to work around - // that, lowering the N at any given step: (s0 + s1 + ... + s63) + (s64 + - // ... + s127) + etc + (etc + ... + sN). - explicitParens, extraComment := len(s) > 128*1024, "" - if explicitParens { - w.printf(`(`) - extraComment = "; the redundant, explicit parens are for https://golang.org/issue/18078" - } - - // Print "" +\n, if a string does not start on its own line. - b := w.buf.Bytes() - if p := len(bytes.TrimRight(b, " \t")); p > 0 && b[p-1] != '\n' { - w.printf("\"\" + // Size: %d bytes%s\n", len(s), extraComment) - n, max = maxWidth, maxWidth - } - - w.printf(`"`) - - for sz, p, nLines := 0, 0, 0; p < len(s); { - var r rune - r, sz = utf8.DecodeRuneInString(s[p:]) - out := s[p : p+sz] - chars := 1 - if !unicode.IsPrint(r) || r == utf8.RuneError || r == '"' { - switch sz { - case 1: - out = fmt.Sprintf("\\x%02x", s[p]) - case 2, 3: - out = fmt.Sprintf("\\u%04x", r) - case 4: - out = fmt.Sprintf("\\U%08x", r) - } - chars = len(out) - } else if r == '\\' { - out = "\\" + string(r) - chars = 2 - } - if n -= chars; n < 0 { - nLines++ - if explicitParens && nLines&63 == 63 { - w.printf("\") + (\"") - } - w.printf("\" +\n\"") - n = max - len(out) - } - w.printf("%s", out) - p += sz - } - w.printf(`"`) - if explicitParens { - w.printf(`)`) - } -} - -// WriteSlice writes a slice value. -func (w *CodeWriter) WriteSlice(x interface{}) { - w.writeSlice(x, false) -} - -// WriteArray writes an array value. -func (w *CodeWriter) WriteArray(x interface{}) { - w.writeSlice(x, true) -} - -func (w *CodeWriter) writeSlice(x interface{}, isArray bool) { - v := reflect.ValueOf(x) - w.gob.Encode(v.Len()) - w.Size += v.Len() * int(v.Type().Elem().Size()) - name := typeName(x) - if isArray { - name = fmt.Sprintf("[%d]%s", v.Len(), name[strings.Index(name, "]")+1:]) - } - if isArray { - w.printf("%s{\n", name) - } else { - w.printf("%s{ // %d elements\n", name, v.Len()) - } - - switch kind := v.Type().Elem().Kind(); kind { - case reflect.String: - for _, s := range x.([]string) { - w.WriteString(s) - w.printf(",\n") - } - case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64, - reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64: - // nLine and nBlock are the number of elements per line and block. - nLine, nBlock, format := 8, 64, "%d," - switch kind { - case reflect.Uint8: - format = "%#02x," - case reflect.Uint16: - format = "%#04x," - case reflect.Uint32: - nLine, nBlock, format = 4, 32, "%#08x," - case reflect.Uint, reflect.Uint64: - nLine, nBlock, format = 4, 32, "%#016x," - case reflect.Int8: - nLine = 16 - } - n := nLine - for i := 0; i < v.Len(); i++ { - if i%nBlock == 0 && v.Len() > nBlock { - w.printf("// Entry %X - %X\n", i, i+nBlock-1) - } - x := v.Index(i).Interface() - w.gob.Encode(x) - w.printf(format, x) - if n--; n == 0 { - n = nLine - w.printf("\n") - } - } - w.printf("\n") - case reflect.Struct: - zero := reflect.Zero(v.Type().Elem()).Interface() - for i := 0; i < v.Len(); i++ { - x := v.Index(i).Interface() - w.gob.EncodeValue(v) - if !reflect.DeepEqual(zero, x) { - line := fmt.Sprintf("%#v,\n", x) - line = line[strings.IndexByte(line, '{'):] - w.printf("%d: ", i) - w.printf(line) - } - } - case reflect.Array: - for i := 0; i < v.Len(); i++ { - w.printf("%d: %#v,\n", i, v.Index(i).Interface()) - } - default: - panic("gen: slice elem type not supported") - } - w.printf("}") -} - -// WriteType writes a definition of the type of the given value and returns the -// type name. -func (w *CodeWriter) WriteType(x interface{}) string { - t := reflect.TypeOf(x) - w.printf("type %s struct {\n", t.Name()) - for i := 0; i < t.NumField(); i++ { - w.printf("\t%s %s\n", t.Field(i).Name, t.Field(i).Type) - } - w.printf("}\n") - return t.Name() -} - -// typeName returns the name of the go type of x. -func typeName(x interface{}) string { - t := reflect.ValueOf(x).Type() - return strings.Replace(fmt.Sprint(t), "main.", "", 1) -} diff --git a/vendor/golang.org/x/text/internal/gen/gen.go b/vendor/golang.org/x/text/internal/gen/gen.go deleted file mode 100644 index 4c3f7606..00000000 --- a/vendor/golang.org/x/text/internal/gen/gen.go +++ /dev/null @@ -1,333 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package gen contains common code for the various code generation tools in the -// text repository. Its usage ensures consistency between tools. -// -// This package defines command line flags that are common to most generation -// tools. The flags allow for specifying specific Unicode and CLDR versions -// in the public Unicode data repository (http://www.unicode.org/Public). -// -// A local Unicode data mirror can be set through the flag -local or the -// environment variable UNICODE_DIR. The former takes precedence. The local -// directory should follow the same structure as the public repository. -// -// IANA data can also optionally be mirrored by putting it in the iana directory -// rooted at the top of the local mirror. Beware, though, that IANA data is not -// versioned. So it is up to the developer to use the right version. -package gen // import "golang.org/x/text/internal/gen" - -import ( - "bytes" - "flag" - "fmt" - "go/build" - "go/format" - "io" - "io/ioutil" - "log" - "net/http" - "os" - "path" - "path/filepath" - "strings" - "sync" - "unicode" - - "golang.org/x/text/unicode/cldr" -) - -var ( - url = flag.String("url", - "http://www.unicode.org/Public", - "URL of Unicode database directory") - iana = flag.String("iana", - "http://www.iana.org", - "URL of the IANA repository") - unicodeVersion = flag.String("unicode", - getEnv("UNICODE_VERSION", unicode.Version), - "unicode version to use") - cldrVersion = flag.String("cldr", - getEnv("CLDR_VERSION", cldr.Version), - "cldr version to use") -) - -func getEnv(name, def string) string { - if v := os.Getenv(name); v != "" { - return v - } - return def -} - -// Init performs common initialization for a gen command. It parses the flags -// and sets up the standard logging parameters. -func Init() { - log.SetPrefix("") - log.SetFlags(log.Lshortfile) - flag.Parse() -} - -const header = `// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -` - -// UnicodeVersion reports the requested Unicode version. -func UnicodeVersion() string { - return *unicodeVersion -} - -// CLDRVersion reports the requested CLDR version. -func CLDRVersion() string { - return *cldrVersion -} - -var tags = []struct{ version, buildTags string }{ - {"10.0.0", "go1.10"}, - {"", "!go1.10"}, -} - -// buildTags reports the build tags used for the current Unicode version. -func buildTags() string { - v := UnicodeVersion() - for _, x := range tags { - // We should do a numeric comparison, but including the collate package - // would create an import cycle. We approximate it by assuming that - // longer version strings are later. - if len(x.version) <= len(v) { - return x.buildTags - } - if len(x.version) == len(v) && x.version <= v { - return x.buildTags - } - } - return tags[0].buildTags -} - -// IsLocal reports whether data files are available locally. -func IsLocal() bool { - dir, err := localReadmeFile() - if err != nil { - return false - } - if _, err = os.Stat(dir); err != nil { - return false - } - return true -} - -// OpenUCDFile opens the requested UCD file. The file is specified relative to -// the public Unicode root directory. It will call log.Fatal if there are any -// errors. -func OpenUCDFile(file string) io.ReadCloser { - return openUnicode(path.Join(*unicodeVersion, "ucd", file)) -} - -// OpenCLDRCoreZip opens the CLDR core zip file. It will call log.Fatal if there -// are any errors. -func OpenCLDRCoreZip() io.ReadCloser { - return OpenUnicodeFile("cldr", *cldrVersion, "core.zip") -} - -// OpenUnicodeFile opens the requested file of the requested category from the -// root of the Unicode data archive. The file is specified relative to the -// public Unicode root directory. If version is "", it will use the default -// Unicode version. It will call log.Fatal if there are any errors. -func OpenUnicodeFile(category, version, file string) io.ReadCloser { - if version == "" { - version = UnicodeVersion() - } - return openUnicode(path.Join(category, version, file)) -} - -// OpenIANAFile opens the requested IANA file. The file is specified relative -// to the IANA root, which is typically either http://www.iana.org or the -// iana directory in the local mirror. It will call log.Fatal if there are any -// errors. -func OpenIANAFile(path string) io.ReadCloser { - return Open(*iana, "iana", path) -} - -var ( - dirMutex sync.Mutex - localDir string -) - -const permissions = 0755 - -func localReadmeFile() (string, error) { - p, err := build.Import("golang.org/x/text", "", build.FindOnly) - if err != nil { - return "", fmt.Errorf("Could not locate package: %v", err) - } - return filepath.Join(p.Dir, "DATA", "README"), nil -} - -func getLocalDir() string { - dirMutex.Lock() - defer dirMutex.Unlock() - - readme, err := localReadmeFile() - if err != nil { - log.Fatal(err) - } - dir := filepath.Dir(readme) - if _, err := os.Stat(readme); err != nil { - if err := os.MkdirAll(dir, permissions); err != nil { - log.Fatalf("Could not create directory: %v", err) - } - ioutil.WriteFile(readme, []byte(readmeTxt), permissions) - } - return dir -} - -const readmeTxt = `Generated by golang.org/x/text/internal/gen. DO NOT EDIT. - -This directory contains downloaded files used to generate the various tables -in the golang.org/x/text subrepo. - -Note that the language subtag repo (iana/assignments/language-subtag-registry) -and all other times in the iana subdirectory are not versioned and will need -to be periodically manually updated. The easiest way to do this is to remove -the entire iana directory. This is mostly of concern when updating the language -package. -` - -// Open opens subdir/path if a local directory is specified and the file exists, -// where subdir is a directory relative to the local root, or fetches it from -// urlRoot/path otherwise. It will call log.Fatal if there are any errors. -func Open(urlRoot, subdir, path string) io.ReadCloser { - file := filepath.Join(getLocalDir(), subdir, filepath.FromSlash(path)) - return open(file, urlRoot, path) -} - -func openUnicode(path string) io.ReadCloser { - file := filepath.Join(getLocalDir(), filepath.FromSlash(path)) - return open(file, *url, path) -} - -// TODO: automatically periodically update non-versioned files. - -func open(file, urlRoot, path string) io.ReadCloser { - if f, err := os.Open(file); err == nil { - return f - } - r := get(urlRoot, path) - defer r.Close() - b, err := ioutil.ReadAll(r) - if err != nil { - log.Fatalf("Could not download file: %v", err) - } - os.MkdirAll(filepath.Dir(file), permissions) - if err := ioutil.WriteFile(file, b, permissions); err != nil { - log.Fatalf("Could not create file: %v", err) - } - return ioutil.NopCloser(bytes.NewReader(b)) -} - -func get(root, path string) io.ReadCloser { - url := root + "/" + path - fmt.Printf("Fetching %s...", url) - defer fmt.Println(" done.") - resp, err := http.Get(url) - if err != nil { - log.Fatalf("HTTP GET: %v", err) - } - if resp.StatusCode != 200 { - log.Fatalf("Bad GET status for %q: %q", url, resp.Status) - } - return resp.Body -} - -// TODO: use Write*Version in all applicable packages. - -// WriteUnicodeVersion writes a constant for the Unicode version from which the -// tables are generated. -func WriteUnicodeVersion(w io.Writer) { - fmt.Fprintf(w, "// UnicodeVersion is the Unicode version from which the tables in this package are derived.\n") - fmt.Fprintf(w, "const UnicodeVersion = %q\n\n", UnicodeVersion()) -} - -// WriteCLDRVersion writes a constant for the CLDR version from which the -// tables are generated. -func WriteCLDRVersion(w io.Writer) { - fmt.Fprintf(w, "// CLDRVersion is the CLDR version from which the tables in this package are derived.\n") - fmt.Fprintf(w, "const CLDRVersion = %q\n\n", CLDRVersion()) -} - -// WriteGoFile prepends a standard file comment and package statement to the -// given bytes, applies gofmt, and writes them to a file with the given name. -// It will call log.Fatal if there are any errors. -func WriteGoFile(filename, pkg string, b []byte) { - w, err := os.Create(filename) - if err != nil { - log.Fatalf("Could not create file %s: %v", filename, err) - } - defer w.Close() - if _, err = WriteGo(w, pkg, "", b); err != nil { - log.Fatalf("Error writing file %s: %v", filename, err) - } -} - -func insertVersion(filename, version string) string { - suffix := ".go" - if strings.HasSuffix(filename, "_test.go") { - suffix = "_test.go" - } - return fmt.Sprint(filename[:len(filename)-len(suffix)], version, suffix) -} - -// WriteVersionedGoFile prepends a standard file comment, adds build tags to -// version the file for the current Unicode version, and package statement to -// the given bytes, applies gofmt, and writes them to a file with the given -// name. It will call log.Fatal if there are any errors. -func WriteVersionedGoFile(filename, pkg string, b []byte) { - tags := buildTags() - if tags != "" { - filename = insertVersion(filename, UnicodeVersion()) - } - w, err := os.Create(filename) - if err != nil { - log.Fatalf("Could not create file %s: %v", filename, err) - } - defer w.Close() - if _, err = WriteGo(w, pkg, tags, b); err != nil { - log.Fatalf("Error writing file %s: %v", filename, err) - } -} - -// WriteGo prepends a standard file comment and package statement to the given -// bytes, applies gofmt, and writes them to w. -func WriteGo(w io.Writer, pkg, tags string, b []byte) (n int, err error) { - src := []byte(header) - if tags != "" { - src = append(src, fmt.Sprintf("// +build %s\n\n", tags)...) - } - src = append(src, fmt.Sprintf("package %s\n\n", pkg)...) - src = append(src, b...) - formatted, err := format.Source(src) - if err != nil { - // Print the generated code even in case of an error so that the - // returned error can be meaningfully interpreted. - n, _ = w.Write(src) - return n, err - } - return w.Write(formatted) -} - -// Repackage rewrites a Go file from belonging to package main to belonging to -// the given package. -func Repackage(inFile, outFile, pkg string) { - src, err := ioutil.ReadFile(inFile) - if err != nil { - log.Fatalf("reading %s: %v", inFile, err) - } - const toDelete = "package main\n\n" - i := bytes.Index(src, []byte(toDelete)) - if i < 0 { - log.Fatalf("Could not find %q in %s.", toDelete, inFile) - } - w := &bytes.Buffer{} - w.Write(src[i+len(toDelete):]) - WriteGoFile(outFile, pkg, w.Bytes()) -} diff --git a/vendor/golang.org/x/text/internal/language/LICENSE b/vendor/golang.org/x/text/internal/language/LICENSE deleted file mode 100644 index 6a66aea5..00000000 --- a/vendor/golang.org/x/text/internal/language/LICENSE +++ /dev/null @@ -1,27 +0,0 @@ -Copyright (c) 2009 The Go Authors. All rights reserved. - -Redistribution and use in source and binary forms, with or without -modification, are permitted provided that the following conditions are -met: - - * Redistributions of source code must retain the above copyright -notice, this list of conditions and the following disclaimer. - * Redistributions in binary form must reproduce the above -copyright notice, this list of conditions and the following disclaimer -in the documentation and/or other materials provided with the -distribution. - * Neither the name of Google Inc. nor the names of its -contributors may be used to endorse or promote products derived from -this software without specific prior written permission. - -THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS -"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT -LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR -A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT -OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, -SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT -LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, -DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY -THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT -(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE -OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go deleted file mode 100644 index cdfdb749..00000000 --- a/vendor/golang.org/x/text/internal/language/common.go +++ /dev/null @@ -1,16 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -// This file contains code common to the maketables.go and the package code. - -// AliasType is the type of an alias in AliasMap. -type AliasType int8 - -const ( - Deprecated AliasType = iota - Macro - Legacy - - AliasTypeUnknown AliasType = -1 -) diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go deleted file mode 100644 index 46a00150..00000000 --- a/vendor/golang.org/x/text/internal/language/compact.go +++ /dev/null @@ -1,29 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -// CompactCoreInfo is a compact integer with the three core tags encoded. -type CompactCoreInfo uint32 - -// GetCompactCore generates a uint32 value that is guaranteed to be unique for -// different language, region, and script values. -func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) { - if t.LangID > langNoIndexOffset { - return 0, false - } - cci |= CompactCoreInfo(t.LangID) << (8 + 12) - cci |= CompactCoreInfo(t.ScriptID) << 12 - cci |= CompactCoreInfo(t.RegionID) - return cci, true -} - -// Tag generates a tag from c. -func (c CompactCoreInfo) Tag() Tag { - return Tag{ - LangID: Language(c >> 20), - RegionID: Region(c & 0x3ff), - ScriptID: Script(c>>12) & 0xff, - } -} diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go deleted file mode 100644 index 1b36935e..00000000 --- a/vendor/golang.org/x/text/internal/language/compact/compact.go +++ /dev/null @@ -1,61 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package compact defines a compact representation of language tags. -// -// Common language tags (at least all for which locale information is defined -// in CLDR) are assigned a unique index. Each Tag is associated with such an -// ID for selecting language-related resources (such as translations) as well -// as one for selecting regional defaults (currency, number formatting, etc.) -// -// It may want to export this functionality at some point, but at this point -// this is only available for use within x/text. -package compact // import "golang.org/x/text/internal/language/compact" - -import ( - "sort" - "strings" - - "golang.org/x/text/internal/language" -) - -// ID is an integer identifying a single tag. -type ID uint16 - -func getCoreIndex(t language.Tag) (id ID, ok bool) { - cci, ok := language.GetCompactCore(t) - if !ok { - return 0, false - } - i := sort.Search(len(coreTags), func(i int) bool { - return cci <= coreTags[i] - }) - if i == len(coreTags) || coreTags[i] != cci { - return 0, false - } - return ID(i), true -} - -// Parent returns the ID of the parent or the root ID if id is already the root. -func (id ID) Parent() ID { - return parents[id] -} - -// Tag converts id to an internal language Tag. -func (id ID) Tag() language.Tag { - if int(id) >= len(coreTags) { - return specialTags[int(id)-len(coreTags)] - } - return coreTags[id].Tag() -} - -var specialTags []language.Tag - -func init() { - tags := strings.Split(specialTagsStr, " ") - specialTags = make([]language.Tag, len(tags)) - for i, t := range tags { - specialTags[i] = language.MustParse(t) - } -} diff --git a/vendor/golang.org/x/text/internal/language/compact/gen.go b/vendor/golang.org/x/text/internal/language/compact/gen.go deleted file mode 100644 index 0c36a052..00000000 --- a/vendor/golang.org/x/text/internal/language/compact/gen.go +++ /dev/null @@ -1,64 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -// Language tag table generator. -// Data read from the web. - -package main - -import ( - "flag" - "fmt" - "log" - - "golang.org/x/text/internal/gen" - "golang.org/x/text/unicode/cldr" -) - -var ( - test = flag.Bool("test", - false, - "test existing tables; can be used to compare web data with package data.") - outputFile = flag.String("output", - "tables.go", - "output file for generated tables") -) - -func main() { - gen.Init() - - w := gen.NewCodeWriter() - defer w.WriteGoFile("tables.go", "compact") - - fmt.Fprintln(w, `import "golang.org/x/text/internal/language"`) - - b := newBuilder(w) - gen.WriteCLDRVersion(w) - - b.writeCompactIndex() -} - -type builder struct { - w *gen.CodeWriter - data *cldr.CLDR - supp *cldr.SupplementalData -} - -func newBuilder(w *gen.CodeWriter) *builder { - r := gen.OpenCLDRCoreZip() - defer r.Close() - d := &cldr.Decoder{} - data, err := d.DecodeZip(r) - if err != nil { - log.Fatal(err) - } - b := builder{ - w: w, - data: data, - supp: data.Supplemental(), - } - return &b -} diff --git a/vendor/golang.org/x/text/internal/language/compact/gen_index.go b/vendor/golang.org/x/text/internal/language/compact/gen_index.go deleted file mode 100644 index 136cefaf..00000000 --- a/vendor/golang.org/x/text/internal/language/compact/gen_index.go +++ /dev/null @@ -1,113 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -package main - -// This file generates derivative tables based on the language package itself. - -import ( - "fmt" - "log" - "sort" - "strings" - - "golang.org/x/text/internal/language" -) - -// Compact indices: -// Note -va-X variants only apply to localization variants. -// BCP variants only ever apply to language. -// The only ambiguity between tags is with regions. - -func (b *builder) writeCompactIndex() { - // Collect all language tags for which we have any data in CLDR. - m := map[language.Tag]bool{} - for _, lang := range b.data.Locales() { - // We include all locales unconditionally to be consistent with en_US. - // We want en_US, even though it has no data associated with it. - - // TODO: put any of the languages for which no data exists at the end - // of the index. This allows all components based on ICU to use that - // as the cutoff point. - // if x := data.RawLDML(lang); false || - // x.LocaleDisplayNames != nil || - // x.Characters != nil || - // x.Delimiters != nil || - // x.Measurement != nil || - // x.Dates != nil || - // x.Numbers != nil || - // x.Units != nil || - // x.ListPatterns != nil || - // x.Collations != nil || - // x.Segmentations != nil || - // x.Rbnf != nil || - // x.Annotations != nil || - // x.Metadata != nil { - - // TODO: support POSIX natively, albeit non-standard. - tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1)) - m[tag] = true - // } - } - - // TODO: plural rules are also defined for the deprecated tags: - // iw mo sh tl - // Consider removing these as compact tags. - - // Include locales for plural rules, which uses a different structure. - for _, plurals := range b.supp.Plurals { - for _, rules := range plurals.PluralRules { - for _, lang := range strings.Split(rules.Locales, " ") { - m[language.Make(lang)] = true - } - } - } - - var coreTags []language.CompactCoreInfo - var special []string - - for t := range m { - if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" { - log.Fatalf("Unexpected extension %v in %v", x, t) - } - if len(t.Variants()) == 0 && len(t.Extensions()) == 0 { - cci, ok := language.GetCompactCore(t) - if !ok { - log.Fatalf("Locale for non-basic language %q", t) - } - coreTags = append(coreTags, cci) - } else { - special = append(special, t.String()) - } - } - - w := b.w - - sort.Slice(coreTags, func(i, j int) bool { return coreTags[i] < coreTags[j] }) - sort.Strings(special) - - w.WriteComment(` - NumCompactTags is the number of common tags. The maximum tag is - NumCompactTags-1.`) - w.WriteConst("NumCompactTags", len(m)) - - fmt.Fprintln(w, "const (") - for i, t := range coreTags { - fmt.Fprintf(w, "%s ID = %d\n", ident(t.Tag().String()), i) - } - for i, t := range special { - fmt.Fprintf(w, "%s ID = %d\n", ident(t), i+len(coreTags)) - } - fmt.Fprintln(w, ")") - - w.WriteVar("coreTags", coreTags) - - w.WriteConst("specialTagsStr", strings.Join(special, " ")) -} - -func ident(s string) string { - return strings.Replace(s, "-", "", -1) + "Index" -} diff --git a/vendor/golang.org/x/text/internal/language/compact/gen_parents.go b/vendor/golang.org/x/text/internal/language/compact/gen_parents.go deleted file mode 100644 index 9543d583..00000000 --- a/vendor/golang.org/x/text/internal/language/compact/gen_parents.go +++ /dev/null @@ -1,54 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -package main - -import ( - "log" - - "golang.org/x/text/internal/gen" - "golang.org/x/text/internal/language" - "golang.org/x/text/internal/language/compact" - "golang.org/x/text/unicode/cldr" -) - -func main() { - r := gen.OpenCLDRCoreZip() - defer r.Close() - - d := &cldr.Decoder{} - data, err := d.DecodeZip(r) - if err != nil { - log.Fatalf("DecodeZip: %v", err) - } - - w := gen.NewCodeWriter() - defer w.WriteGoFile("parents.go", "compact") - - // Create parents table. - type ID uint16 - parents := make([]ID, compact.NumCompactTags) - for _, loc := range data.Locales() { - tag := language.MustParse(loc) - index, ok := compact.FromTag(tag) - if !ok { - continue - } - parentIndex := compact.ID(0) // und - for p := tag.Parent(); p != language.Und; p = p.Parent() { - if x, ok := compact.FromTag(p); ok { - parentIndex = x - break - } - } - parents[index] = ID(parentIndex) - } - - w.WriteComment(` - parents maps a compact index of a tag to the compact index of the parent of - this tag.`) - w.WriteVar("parents", parents) -} diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go deleted file mode 100644 index 83816a72..00000000 --- a/vendor/golang.org/x/text/internal/language/compact/language.go +++ /dev/null @@ -1,260 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate go run gen.go gen_index.go -output tables.go -//go:generate go run gen_parents.go - -package compact - -// TODO: Remove above NOTE after: -// - verifying that tables are dropped correctly (most notably matcher tables). - -import ( - "strings" - - "golang.org/x/text/internal/language" -) - -// Tag represents a BCP 47 language tag. It is used to specify an instance of a -// specific language or locale. All language tag values are guaranteed to be -// well-formed. -type Tag struct { - // NOTE: exported tags will become part of the public API. - language ID - locale ID - full fullTag // always a language.Tag for now. -} - -const _und = 0 - -type fullTag interface { - IsRoot() bool - Parent() language.Tag -} - -// Make a compact Tag from a fully specified internal language Tag. -func Make(t language.Tag) (tag Tag) { - if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" { - if r, err := language.ParseRegion(region[:2]); err == nil { - tFull := t - t, _ = t.SetTypeForKey("rg", "") - // TODO: should we not consider "va" for the language tag? - var exact1, exact2 bool - tag.language, exact1 = FromTag(t) - t.RegionID = r - tag.locale, exact2 = FromTag(t) - if !exact1 || !exact2 { - tag.full = tFull - } - return tag - } - } - lang, ok := FromTag(t) - tag.language = lang - tag.locale = lang - if !ok { - tag.full = t - } - return tag -} - -// Tag returns an internal language Tag version of this tag. -func (t Tag) Tag() language.Tag { - if t.full != nil { - return t.full.(language.Tag) - } - tag := t.language.Tag() - if t.language != t.locale { - loc := t.locale.Tag() - tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz") - } - return tag -} - -// IsCompact reports whether this tag is fully defined in terms of ID. -func (t *Tag) IsCompact() bool { - return t.full == nil -} - -// MayHaveVariants reports whether a tag may have variants. If it returns false -// it is guaranteed the tag does not have variants. -func (t Tag) MayHaveVariants() bool { - return t.full != nil || int(t.language) >= len(coreTags) -} - -// MayHaveExtensions reports whether a tag may have extensions. If it returns -// false it is guaranteed the tag does not have them. -func (t Tag) MayHaveExtensions() bool { - return t.full != nil || - int(t.language) >= len(coreTags) || - t.language != t.locale -} - -// IsRoot returns true if t is equal to language "und". -func (t Tag) IsRoot() bool { - if t.full != nil { - return t.full.IsRoot() - } - return t.language == _und -} - -// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a -// specific language are substituted with fields from the parent language. -// The parent for a language may change for newer versions of CLDR. -func (t Tag) Parent() Tag { - if t.full != nil { - return Make(t.full.Parent()) - } - if t.language != t.locale { - // Simulate stripping -u-rg-xxxxxx - return Tag{language: t.language, locale: t.language} - } - // TODO: use parent lookup table once cycle from internal package is - // removed. Probably by internalizing the table and declaring this fast - // enough. - // lang := compactID(internal.Parent(uint16(t.language))) - lang, _ := FromTag(t.language.Tag().Parent()) - return Tag{language: lang, locale: lang} -} - -// returns token t and the rest of the string. -func nextToken(s string) (t, tail string) { - p := strings.Index(s[1:], "-") - if p == -1 { - return s[1:], "" - } - p++ - return s[1:p], s[p:] -} - -// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags -// for which data exists in the text repository.The index will change over time -// and should not be stored in persistent storage. If t does not match a compact -// index, exact will be false and the compact index will be returned for the -// first match after repeatedly taking the Parent of t. -func LanguageID(t Tag) (id ID, exact bool) { - return t.language, t.full == nil -} - -// RegionalID returns the ID for the regional variant of this tag. This index is -// used to indicate region-specific overrides, such as default currency, default -// calendar and week data, default time cycle, and default measurement system -// and unit preferences. -// -// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US -// settings for currency, number formatting, etc. The CompactIndex for this tag -// will be that for en-GB, while the RegionalID will be the one corresponding to -// en-US. -func RegionalID(t Tag) (id ID, exact bool) { - return t.locale, t.full == nil -} - -// LanguageTag returns t stripped of regional variant indicators. -// -// At the moment this means it is stripped of a regional and variant subtag "rg" -// and "va" in the "u" extension. -func (t Tag) LanguageTag() Tag { - if t.full == nil { - return Tag{language: t.language, locale: t.language} - } - tt := t.Tag() - tt.SetTypeForKey("rg", "") - tt.SetTypeForKey("va", "") - return Make(tt) -} - -// RegionalTag returns the regional variant of the tag. -// -// At the moment this means that the region is set from the regional subtag -// "rg" in the "u" extension. -func (t Tag) RegionalTag() Tag { - rt := Tag{language: t.locale, locale: t.locale} - if t.full == nil { - return rt - } - b := language.Builder{} - tag := t.Tag() - // tag, _ = tag.SetTypeForKey("rg", "") - b.SetTag(t.locale.Tag()) - if v := tag.Variants(); v != "" { - for _, v := range strings.Split(v, "-") { - b.AddVariant(v) - } - } - for _, e := range tag.Extensions() { - b.AddExt(e) - } - return t -} - -// FromTag reports closest matching ID for an internal language Tag. -func FromTag(t language.Tag) (id ID, exact bool) { - // TODO: perhaps give more frequent tags a lower index. - // TODO: we could make the indexes stable. This will excluded some - // possibilities for optimization, so don't do this quite yet. - exact = true - - b, s, r := t.Raw() - if t.HasString() { - if t.IsPrivateUse() { - // We have no entries for user-defined tags. - return 0, false - } - hasExtra := false - if t.HasVariants() { - if t.HasExtensions() { - build := language.Builder{} - build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r}) - build.AddVariant(t.Variants()) - exact = false - t = build.Make() - } - hasExtra = true - } else if _, ok := t.Extension('u'); ok { - // TODO: va may mean something else. Consider not considering it. - // Strip all but the 'va' entry. - old := t - variant := t.TypeForKey("va") - t = language.Tag{LangID: b, ScriptID: s, RegionID: r} - if variant != "" { - t, _ = t.SetTypeForKey("va", variant) - hasExtra = true - } - exact = old == t - } else { - exact = false - } - if hasExtra { - // We have some variants. - for i, s := range specialTags { - if s == t { - return ID(i + len(coreTags)), exact - } - } - exact = false - } - } - if x, ok := getCoreIndex(t); ok { - return x, exact - } - exact = false - if r != 0 && s == 0 { - // Deal with cases where an extra script is inserted for the region. - t, _ := t.Maximize() - if x, ok := getCoreIndex(t); ok { - return x, exact - } - } - for t = t.Parent(); t != root; t = t.Parent() { - // No variants specified: just compare core components. - // The key has the form lllssrrr, where l, s, and r are nibbles for - // respectively the langID, scriptID, and regionID. - if x, ok := getCoreIndex(t); ok { - return x, exact - } - } - return 0, exact -} - -var root = language.Tag{} diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go deleted file mode 100644 index 8d810723..00000000 --- a/vendor/golang.org/x/text/internal/language/compact/parents.go +++ /dev/null @@ -1,120 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package compact - -// parents maps a compact index of a tag to the compact index of the parent of -// this tag. -var parents = []ID{ // 775 elements - // Entry 0 - 3F - 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006, - 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, - 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, - 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, - 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000, - 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000, - 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000, - 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e, - // Entry 40 - 7F - 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046, - 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000, - 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000, - 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d, - 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066, - 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b, - 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000, - 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e, - // Entry 80 - BF - 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086, - 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087, - 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, - 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087, - 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086, - // Entry C0 - FF - 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, - 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, - 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087, - 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000, - 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, - 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1, - // Entry 100 - 13F - 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, - 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e, - 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000, - 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e, - 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - // Entry 140 - 17F - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, - 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156, - 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c, - 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000, - 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000, - 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176, - 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e, - // Entry 180 - 1BF - 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184, - 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e, - 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000, - 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000, - 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, - 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000, - 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6, - 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000, - // Entry 1C0 - 1FF - 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000, - 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb, - 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000, - 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000, - 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, - 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, - 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5, - 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000, - // Entry 200 - 23F - 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000, - 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000, - 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000, - 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000, - 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226, - 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000, - 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236, - 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244, - // Entry 240 - 27F - 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000, - 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000, - 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254, - 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000, - 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, - 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e, - 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273, - 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000, - // Entry 280 - 2BF - 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286, - 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000, - 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295, - 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d, - 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000, - 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae, - 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5, - 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000, - // Entry 2C0 - 2FF - 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000, - 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd, - 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000, - 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000, - 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6, - 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000, - 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000, - 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000, - // Entry 300 - 33F - 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6, -} // Size: 1574 bytes - -// Total table size 1574 bytes (1KiB); checksum: 895AAF0B diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go deleted file mode 100644 index 554ca354..00000000 --- a/vendor/golang.org/x/text/internal/language/compact/tables.go +++ /dev/null @@ -1,1015 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package compact - -import "golang.org/x/text/internal/language" - -// CLDRVersion is the CLDR version from which the tables in this package are derived. -const CLDRVersion = "32" - -// NumCompactTags is the number of common tags. The maximum tag is -// NumCompactTags-1. -const NumCompactTags = 775 -const ( - undIndex ID = 0 - afIndex ID = 1 - afNAIndex ID = 2 - afZAIndex ID = 3 - agqIndex ID = 4 - agqCMIndex ID = 5 - akIndex ID = 6 - akGHIndex ID = 7 - amIndex ID = 8 - amETIndex ID = 9 - arIndex ID = 10 - ar001Index ID = 11 - arAEIndex ID = 12 - arBHIndex ID = 13 - arDJIndex ID = 14 - arDZIndex ID = 15 - arEGIndex ID = 16 - arEHIndex ID = 17 - arERIndex ID = 18 - arILIndex ID = 19 - arIQIndex ID = 20 - arJOIndex ID = 21 - arKMIndex ID = 22 - arKWIndex ID = 23 - arLBIndex ID = 24 - arLYIndex ID = 25 - arMAIndex ID = 26 - arMRIndex ID = 27 - arOMIndex ID = 28 - arPSIndex ID = 29 - arQAIndex ID = 30 - arSAIndex ID = 31 - arSDIndex ID = 32 - arSOIndex ID = 33 - arSSIndex ID = 34 - arSYIndex ID = 35 - arTDIndex ID = 36 - arTNIndex ID = 37 - arYEIndex ID = 38 - arsIndex ID = 39 - asIndex ID = 40 - asINIndex ID = 41 - asaIndex ID = 42 - asaTZIndex ID = 43 - astIndex ID = 44 - astESIndex ID = 45 - azIndex ID = 46 - azCyrlIndex ID = 47 - azCyrlAZIndex ID = 48 - azLatnIndex ID = 49 - azLatnAZIndex ID = 50 - basIndex ID = 51 - basCMIndex ID = 52 - beIndex ID = 53 - beBYIndex ID = 54 - bemIndex ID = 55 - bemZMIndex ID = 56 - bezIndex ID = 57 - bezTZIndex ID = 58 - bgIndex ID = 59 - bgBGIndex ID = 60 - bhIndex ID = 61 - bmIndex ID = 62 - bmMLIndex ID = 63 - bnIndex ID = 64 - bnBDIndex ID = 65 - bnINIndex ID = 66 - boIndex ID = 67 - boCNIndex ID = 68 - boINIndex ID = 69 - brIndex ID = 70 - brFRIndex ID = 71 - brxIndex ID = 72 - brxINIndex ID = 73 - bsIndex ID = 74 - bsCyrlIndex ID = 75 - bsCyrlBAIndex ID = 76 - bsLatnIndex ID = 77 - bsLatnBAIndex ID = 78 - caIndex ID = 79 - caADIndex ID = 80 - caESIndex ID = 81 - caFRIndex ID = 82 - caITIndex ID = 83 - ccpIndex ID = 84 - ccpBDIndex ID = 85 - ccpINIndex ID = 86 - ceIndex ID = 87 - ceRUIndex ID = 88 - cggIndex ID = 89 - cggUGIndex ID = 90 - chrIndex ID = 91 - chrUSIndex ID = 92 - ckbIndex ID = 93 - ckbIQIndex ID = 94 - ckbIRIndex ID = 95 - csIndex ID = 96 - csCZIndex ID = 97 - cuIndex ID = 98 - cuRUIndex ID = 99 - cyIndex ID = 100 - cyGBIndex ID = 101 - daIndex ID = 102 - daDKIndex ID = 103 - daGLIndex ID = 104 - davIndex ID = 105 - davKEIndex ID = 106 - deIndex ID = 107 - deATIndex ID = 108 - deBEIndex ID = 109 - deCHIndex ID = 110 - deDEIndex ID = 111 - deITIndex ID = 112 - deLIIndex ID = 113 - deLUIndex ID = 114 - djeIndex ID = 115 - djeNEIndex ID = 116 - dsbIndex ID = 117 - dsbDEIndex ID = 118 - duaIndex ID = 119 - duaCMIndex ID = 120 - dvIndex ID = 121 - dyoIndex ID = 122 - dyoSNIndex ID = 123 - dzIndex ID = 124 - dzBTIndex ID = 125 - ebuIndex ID = 126 - ebuKEIndex ID = 127 - eeIndex ID = 128 - eeGHIndex ID = 129 - eeTGIndex ID = 130 - elIndex ID = 131 - elCYIndex ID = 132 - elGRIndex ID = 133 - enIndex ID = 134 - en001Index ID = 135 - en150Index ID = 136 - enAGIndex ID = 137 - enAIIndex ID = 138 - enASIndex ID = 139 - enATIndex ID = 140 - enAUIndex ID = 141 - enBBIndex ID = 142 - enBEIndex ID = 143 - enBIIndex ID = 144 - enBMIndex ID = 145 - enBSIndex ID = 146 - enBWIndex ID = 147 - enBZIndex ID = 148 - enCAIndex ID = 149 - enCCIndex ID = 150 - enCHIndex ID = 151 - enCKIndex ID = 152 - enCMIndex ID = 153 - enCXIndex ID = 154 - enCYIndex ID = 155 - enDEIndex ID = 156 - enDGIndex ID = 157 - enDKIndex ID = 158 - enDMIndex ID = 159 - enERIndex ID = 160 - enFIIndex ID = 161 - enFJIndex ID = 162 - enFKIndex ID = 163 - enFMIndex ID = 164 - enGBIndex ID = 165 - enGDIndex ID = 166 - enGGIndex ID = 167 - enGHIndex ID = 168 - enGIIndex ID = 169 - enGMIndex ID = 170 - enGUIndex ID = 171 - enGYIndex ID = 172 - enHKIndex ID = 173 - enIEIndex ID = 174 - enILIndex ID = 175 - enIMIndex ID = 176 - enINIndex ID = 177 - enIOIndex ID = 178 - enJEIndex ID = 179 - enJMIndex ID = 180 - enKEIndex ID = 181 - enKIIndex ID = 182 - enKNIndex ID = 183 - enKYIndex ID = 184 - enLCIndex ID = 185 - enLRIndex ID = 186 - enLSIndex ID = 187 - enMGIndex ID = 188 - enMHIndex ID = 189 - enMOIndex ID = 190 - enMPIndex ID = 191 - enMSIndex ID = 192 - enMTIndex ID = 193 - enMUIndex ID = 194 - enMWIndex ID = 195 - enMYIndex ID = 196 - enNAIndex ID = 197 - enNFIndex ID = 198 - enNGIndex ID = 199 - enNLIndex ID = 200 - enNRIndex ID = 201 - enNUIndex ID = 202 - enNZIndex ID = 203 - enPGIndex ID = 204 - enPHIndex ID = 205 - enPKIndex ID = 206 - enPNIndex ID = 207 - enPRIndex ID = 208 - enPWIndex ID = 209 - enRWIndex ID = 210 - enSBIndex ID = 211 - enSCIndex ID = 212 - enSDIndex ID = 213 - enSEIndex ID = 214 - enSGIndex ID = 215 - enSHIndex ID = 216 - enSIIndex ID = 217 - enSLIndex ID = 218 - enSSIndex ID = 219 - enSXIndex ID = 220 - enSZIndex ID = 221 - enTCIndex ID = 222 - enTKIndex ID = 223 - enTOIndex ID = 224 - enTTIndex ID = 225 - enTVIndex ID = 226 - enTZIndex ID = 227 - enUGIndex ID = 228 - enUMIndex ID = 229 - enUSIndex ID = 230 - enVCIndex ID = 231 - enVGIndex ID = 232 - enVIIndex ID = 233 - enVUIndex ID = 234 - enWSIndex ID = 235 - enZAIndex ID = 236 - enZMIndex ID = 237 - enZWIndex ID = 238 - eoIndex ID = 239 - eo001Index ID = 240 - esIndex ID = 241 - es419Index ID = 242 - esARIndex ID = 243 - esBOIndex ID = 244 - esBRIndex ID = 245 - esBZIndex ID = 246 - esCLIndex ID = 247 - esCOIndex ID = 248 - esCRIndex ID = 249 - esCUIndex ID = 250 - esDOIndex ID = 251 - esEAIndex ID = 252 - esECIndex ID = 253 - esESIndex ID = 254 - esGQIndex ID = 255 - esGTIndex ID = 256 - esHNIndex ID = 257 - esICIndex ID = 258 - esMXIndex ID = 259 - esNIIndex ID = 260 - esPAIndex ID = 261 - esPEIndex ID = 262 - esPHIndex ID = 263 - esPRIndex ID = 264 - esPYIndex ID = 265 - esSVIndex ID = 266 - esUSIndex ID = 267 - esUYIndex ID = 268 - esVEIndex ID = 269 - etIndex ID = 270 - etEEIndex ID = 271 - euIndex ID = 272 - euESIndex ID = 273 - ewoIndex ID = 274 - ewoCMIndex ID = 275 - faIndex ID = 276 - faAFIndex ID = 277 - faIRIndex ID = 278 - ffIndex ID = 279 - ffCMIndex ID = 280 - ffGNIndex ID = 281 - ffMRIndex ID = 282 - ffSNIndex ID = 283 - fiIndex ID = 284 - fiFIIndex ID = 285 - filIndex ID = 286 - filPHIndex ID = 287 - foIndex ID = 288 - foDKIndex ID = 289 - foFOIndex ID = 290 - frIndex ID = 291 - frBEIndex ID = 292 - frBFIndex ID = 293 - frBIIndex ID = 294 - frBJIndex ID = 295 - frBLIndex ID = 296 - frCAIndex ID = 297 - frCDIndex ID = 298 - frCFIndex ID = 299 - frCGIndex ID = 300 - frCHIndex ID = 301 - frCIIndex ID = 302 - frCMIndex ID = 303 - frDJIndex ID = 304 - frDZIndex ID = 305 - frFRIndex ID = 306 - frGAIndex ID = 307 - frGFIndex ID = 308 - frGNIndex ID = 309 - frGPIndex ID = 310 - frGQIndex ID = 311 - frHTIndex ID = 312 - frKMIndex ID = 313 - frLUIndex ID = 314 - frMAIndex ID = 315 - frMCIndex ID = 316 - frMFIndex ID = 317 - frMGIndex ID = 318 - frMLIndex ID = 319 - frMQIndex ID = 320 - frMRIndex ID = 321 - frMUIndex ID = 322 - frNCIndex ID = 323 - frNEIndex ID = 324 - frPFIndex ID = 325 - frPMIndex ID = 326 - frREIndex ID = 327 - frRWIndex ID = 328 - frSCIndex ID = 329 - frSNIndex ID = 330 - frSYIndex ID = 331 - frTDIndex ID = 332 - frTGIndex ID = 333 - frTNIndex ID = 334 - frVUIndex ID = 335 - frWFIndex ID = 336 - frYTIndex ID = 337 - furIndex ID = 338 - furITIndex ID = 339 - fyIndex ID = 340 - fyNLIndex ID = 341 - gaIndex ID = 342 - gaIEIndex ID = 343 - gdIndex ID = 344 - gdGBIndex ID = 345 - glIndex ID = 346 - glESIndex ID = 347 - gswIndex ID = 348 - gswCHIndex ID = 349 - gswFRIndex ID = 350 - gswLIIndex ID = 351 - guIndex ID = 352 - guINIndex ID = 353 - guwIndex ID = 354 - guzIndex ID = 355 - guzKEIndex ID = 356 - gvIndex ID = 357 - gvIMIndex ID = 358 - haIndex ID = 359 - haGHIndex ID = 360 - haNEIndex ID = 361 - haNGIndex ID = 362 - hawIndex ID = 363 - hawUSIndex ID = 364 - heIndex ID = 365 - heILIndex ID = 366 - hiIndex ID = 367 - hiINIndex ID = 368 - hrIndex ID = 369 - hrBAIndex ID = 370 - hrHRIndex ID = 371 - hsbIndex ID = 372 - hsbDEIndex ID = 373 - huIndex ID = 374 - huHUIndex ID = 375 - hyIndex ID = 376 - hyAMIndex ID = 377 - idIndex ID = 378 - idIDIndex ID = 379 - igIndex ID = 380 - igNGIndex ID = 381 - iiIndex ID = 382 - iiCNIndex ID = 383 - inIndex ID = 384 - ioIndex ID = 385 - isIndex ID = 386 - isISIndex ID = 387 - itIndex ID = 388 - itCHIndex ID = 389 - itITIndex ID = 390 - itSMIndex ID = 391 - itVAIndex ID = 392 - iuIndex ID = 393 - iwIndex ID = 394 - jaIndex ID = 395 - jaJPIndex ID = 396 - jboIndex ID = 397 - jgoIndex ID = 398 - jgoCMIndex ID = 399 - jiIndex ID = 400 - jmcIndex ID = 401 - jmcTZIndex ID = 402 - jvIndex ID = 403 - jwIndex ID = 404 - kaIndex ID = 405 - kaGEIndex ID = 406 - kabIndex ID = 407 - kabDZIndex ID = 408 - kajIndex ID = 409 - kamIndex ID = 410 - kamKEIndex ID = 411 - kcgIndex ID = 412 - kdeIndex ID = 413 - kdeTZIndex ID = 414 - keaIndex ID = 415 - keaCVIndex ID = 416 - khqIndex ID = 417 - khqMLIndex ID = 418 - kiIndex ID = 419 - kiKEIndex ID = 420 - kkIndex ID = 421 - kkKZIndex ID = 422 - kkjIndex ID = 423 - kkjCMIndex ID = 424 - klIndex ID = 425 - klGLIndex ID = 426 - klnIndex ID = 427 - klnKEIndex ID = 428 - kmIndex ID = 429 - kmKHIndex ID = 430 - knIndex ID = 431 - knINIndex ID = 432 - koIndex ID = 433 - koKPIndex ID = 434 - koKRIndex ID = 435 - kokIndex ID = 436 - kokINIndex ID = 437 - ksIndex ID = 438 - ksINIndex ID = 439 - ksbIndex ID = 440 - ksbTZIndex ID = 441 - ksfIndex ID = 442 - ksfCMIndex ID = 443 - kshIndex ID = 444 - kshDEIndex ID = 445 - kuIndex ID = 446 - kwIndex ID = 447 - kwGBIndex ID = 448 - kyIndex ID = 449 - kyKGIndex ID = 450 - lagIndex ID = 451 - lagTZIndex ID = 452 - lbIndex ID = 453 - lbLUIndex ID = 454 - lgIndex ID = 455 - lgUGIndex ID = 456 - lktIndex ID = 457 - lktUSIndex ID = 458 - lnIndex ID = 459 - lnAOIndex ID = 460 - lnCDIndex ID = 461 - lnCFIndex ID = 462 - lnCGIndex ID = 463 - loIndex ID = 464 - loLAIndex ID = 465 - lrcIndex ID = 466 - lrcIQIndex ID = 467 - lrcIRIndex ID = 468 - ltIndex ID = 469 - ltLTIndex ID = 470 - luIndex ID = 471 - luCDIndex ID = 472 - luoIndex ID = 473 - luoKEIndex ID = 474 - luyIndex ID = 475 - luyKEIndex ID = 476 - lvIndex ID = 477 - lvLVIndex ID = 478 - masIndex ID = 479 - masKEIndex ID = 480 - masTZIndex ID = 481 - merIndex ID = 482 - merKEIndex ID = 483 - mfeIndex ID = 484 - mfeMUIndex ID = 485 - mgIndex ID = 486 - mgMGIndex ID = 487 - mghIndex ID = 488 - mghMZIndex ID = 489 - mgoIndex ID = 490 - mgoCMIndex ID = 491 - mkIndex ID = 492 - mkMKIndex ID = 493 - mlIndex ID = 494 - mlINIndex ID = 495 - mnIndex ID = 496 - mnMNIndex ID = 497 - moIndex ID = 498 - mrIndex ID = 499 - mrINIndex ID = 500 - msIndex ID = 501 - msBNIndex ID = 502 - msMYIndex ID = 503 - msSGIndex ID = 504 - mtIndex ID = 505 - mtMTIndex ID = 506 - muaIndex ID = 507 - muaCMIndex ID = 508 - myIndex ID = 509 - myMMIndex ID = 510 - mznIndex ID = 511 - mznIRIndex ID = 512 - nahIndex ID = 513 - naqIndex ID = 514 - naqNAIndex ID = 515 - nbIndex ID = 516 - nbNOIndex ID = 517 - nbSJIndex ID = 518 - ndIndex ID = 519 - ndZWIndex ID = 520 - ndsIndex ID = 521 - ndsDEIndex ID = 522 - ndsNLIndex ID = 523 - neIndex ID = 524 - neINIndex ID = 525 - neNPIndex ID = 526 - nlIndex ID = 527 - nlAWIndex ID = 528 - nlBEIndex ID = 529 - nlBQIndex ID = 530 - nlCWIndex ID = 531 - nlNLIndex ID = 532 - nlSRIndex ID = 533 - nlSXIndex ID = 534 - nmgIndex ID = 535 - nmgCMIndex ID = 536 - nnIndex ID = 537 - nnNOIndex ID = 538 - nnhIndex ID = 539 - nnhCMIndex ID = 540 - noIndex ID = 541 - nqoIndex ID = 542 - nrIndex ID = 543 - nsoIndex ID = 544 - nusIndex ID = 545 - nusSSIndex ID = 546 - nyIndex ID = 547 - nynIndex ID = 548 - nynUGIndex ID = 549 - omIndex ID = 550 - omETIndex ID = 551 - omKEIndex ID = 552 - orIndex ID = 553 - orINIndex ID = 554 - osIndex ID = 555 - osGEIndex ID = 556 - osRUIndex ID = 557 - paIndex ID = 558 - paArabIndex ID = 559 - paArabPKIndex ID = 560 - paGuruIndex ID = 561 - paGuruINIndex ID = 562 - papIndex ID = 563 - plIndex ID = 564 - plPLIndex ID = 565 - prgIndex ID = 566 - prg001Index ID = 567 - psIndex ID = 568 - psAFIndex ID = 569 - ptIndex ID = 570 - ptAOIndex ID = 571 - ptBRIndex ID = 572 - ptCHIndex ID = 573 - ptCVIndex ID = 574 - ptGQIndex ID = 575 - ptGWIndex ID = 576 - ptLUIndex ID = 577 - ptMOIndex ID = 578 - ptMZIndex ID = 579 - ptPTIndex ID = 580 - ptSTIndex ID = 581 - ptTLIndex ID = 582 - quIndex ID = 583 - quBOIndex ID = 584 - quECIndex ID = 585 - quPEIndex ID = 586 - rmIndex ID = 587 - rmCHIndex ID = 588 - rnIndex ID = 589 - rnBIIndex ID = 590 - roIndex ID = 591 - roMDIndex ID = 592 - roROIndex ID = 593 - rofIndex ID = 594 - rofTZIndex ID = 595 - ruIndex ID = 596 - ruBYIndex ID = 597 - ruKGIndex ID = 598 - ruKZIndex ID = 599 - ruMDIndex ID = 600 - ruRUIndex ID = 601 - ruUAIndex ID = 602 - rwIndex ID = 603 - rwRWIndex ID = 604 - rwkIndex ID = 605 - rwkTZIndex ID = 606 - sahIndex ID = 607 - sahRUIndex ID = 608 - saqIndex ID = 609 - saqKEIndex ID = 610 - sbpIndex ID = 611 - sbpTZIndex ID = 612 - sdIndex ID = 613 - sdPKIndex ID = 614 - sdhIndex ID = 615 - seIndex ID = 616 - seFIIndex ID = 617 - seNOIndex ID = 618 - seSEIndex ID = 619 - sehIndex ID = 620 - sehMZIndex ID = 621 - sesIndex ID = 622 - sesMLIndex ID = 623 - sgIndex ID = 624 - sgCFIndex ID = 625 - shIndex ID = 626 - shiIndex ID = 627 - shiLatnIndex ID = 628 - shiLatnMAIndex ID = 629 - shiTfngIndex ID = 630 - shiTfngMAIndex ID = 631 - siIndex ID = 632 - siLKIndex ID = 633 - skIndex ID = 634 - skSKIndex ID = 635 - slIndex ID = 636 - slSIIndex ID = 637 - smaIndex ID = 638 - smiIndex ID = 639 - smjIndex ID = 640 - smnIndex ID = 641 - smnFIIndex ID = 642 - smsIndex ID = 643 - snIndex ID = 644 - snZWIndex ID = 645 - soIndex ID = 646 - soDJIndex ID = 647 - soETIndex ID = 648 - soKEIndex ID = 649 - soSOIndex ID = 650 - sqIndex ID = 651 - sqALIndex ID = 652 - sqMKIndex ID = 653 - sqXKIndex ID = 654 - srIndex ID = 655 - srCyrlIndex ID = 656 - srCyrlBAIndex ID = 657 - srCyrlMEIndex ID = 658 - srCyrlRSIndex ID = 659 - srCyrlXKIndex ID = 660 - srLatnIndex ID = 661 - srLatnBAIndex ID = 662 - srLatnMEIndex ID = 663 - srLatnRSIndex ID = 664 - srLatnXKIndex ID = 665 - ssIndex ID = 666 - ssyIndex ID = 667 - stIndex ID = 668 - svIndex ID = 669 - svAXIndex ID = 670 - svFIIndex ID = 671 - svSEIndex ID = 672 - swIndex ID = 673 - swCDIndex ID = 674 - swKEIndex ID = 675 - swTZIndex ID = 676 - swUGIndex ID = 677 - syrIndex ID = 678 - taIndex ID = 679 - taINIndex ID = 680 - taLKIndex ID = 681 - taMYIndex ID = 682 - taSGIndex ID = 683 - teIndex ID = 684 - teINIndex ID = 685 - teoIndex ID = 686 - teoKEIndex ID = 687 - teoUGIndex ID = 688 - tgIndex ID = 689 - tgTJIndex ID = 690 - thIndex ID = 691 - thTHIndex ID = 692 - tiIndex ID = 693 - tiERIndex ID = 694 - tiETIndex ID = 695 - tigIndex ID = 696 - tkIndex ID = 697 - tkTMIndex ID = 698 - tlIndex ID = 699 - tnIndex ID = 700 - toIndex ID = 701 - toTOIndex ID = 702 - trIndex ID = 703 - trCYIndex ID = 704 - trTRIndex ID = 705 - tsIndex ID = 706 - ttIndex ID = 707 - ttRUIndex ID = 708 - twqIndex ID = 709 - twqNEIndex ID = 710 - tzmIndex ID = 711 - tzmMAIndex ID = 712 - ugIndex ID = 713 - ugCNIndex ID = 714 - ukIndex ID = 715 - ukUAIndex ID = 716 - urIndex ID = 717 - urINIndex ID = 718 - urPKIndex ID = 719 - uzIndex ID = 720 - uzArabIndex ID = 721 - uzArabAFIndex ID = 722 - uzCyrlIndex ID = 723 - uzCyrlUZIndex ID = 724 - uzLatnIndex ID = 725 - uzLatnUZIndex ID = 726 - vaiIndex ID = 727 - vaiLatnIndex ID = 728 - vaiLatnLRIndex ID = 729 - vaiVaiiIndex ID = 730 - vaiVaiiLRIndex ID = 731 - veIndex ID = 732 - viIndex ID = 733 - viVNIndex ID = 734 - voIndex ID = 735 - vo001Index ID = 736 - vunIndex ID = 737 - vunTZIndex ID = 738 - waIndex ID = 739 - waeIndex ID = 740 - waeCHIndex ID = 741 - woIndex ID = 742 - woSNIndex ID = 743 - xhIndex ID = 744 - xogIndex ID = 745 - xogUGIndex ID = 746 - yavIndex ID = 747 - yavCMIndex ID = 748 - yiIndex ID = 749 - yi001Index ID = 750 - yoIndex ID = 751 - yoBJIndex ID = 752 - yoNGIndex ID = 753 - yueIndex ID = 754 - yueHansIndex ID = 755 - yueHansCNIndex ID = 756 - yueHantIndex ID = 757 - yueHantHKIndex ID = 758 - zghIndex ID = 759 - zghMAIndex ID = 760 - zhIndex ID = 761 - zhHansIndex ID = 762 - zhHansCNIndex ID = 763 - zhHansHKIndex ID = 764 - zhHansMOIndex ID = 765 - zhHansSGIndex ID = 766 - zhHantIndex ID = 767 - zhHantHKIndex ID = 768 - zhHantMOIndex ID = 769 - zhHantTWIndex ID = 770 - zuIndex ID = 771 - zuZAIndex ID = 772 - caESvalenciaIndex ID = 773 - enUSuvaposixIndex ID = 774 -) - -var coreTags = []language.CompactCoreInfo{ // 773 elements - // Entry 0 - 1F - 0x00000000, 0x01600000, 0x016000d2, 0x01600161, - 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, - 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, - 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, - 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, - 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, - 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, - 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, - // Entry 20 - 3F - 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, - 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, - 0x04300000, 0x04300099, 0x04400000, 0x0440012f, - 0x04800000, 0x0480006e, 0x05800000, 0x0581f000, - 0x0581f032, 0x05857000, 0x05857032, 0x05e00000, - 0x05e00052, 0x07100000, 0x07100047, 0x07500000, - 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, - 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, - // Entry 40 - 5F - 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, - 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, - 0x0b500000, 0x0b500099, 0x0b700000, 0x0b71f000, - 0x0b71f033, 0x0b757000, 0x0b757033, 0x0d700000, - 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, - 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, - 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, - 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, - // Entry 60 - 7F - 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, - 0x10000000, 0x1000007b, 0x10100000, 0x10100063, - 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, - 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, - 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, - 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, - 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, - 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, - // Entry 80 - 9F - 0x13000000, 0x13000080, 0x13000122, 0x13600000, - 0x1360005d, 0x13600087, 0x13900000, 0x13900001, - 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, - 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, - 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, - 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, - 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, - 0x13900060, 0x13900061, 0x13900063, 0x13900064, - // Entry A0 - BF - 0x1390006d, 0x13900072, 0x13900073, 0x13900074, - 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, - 0x13900080, 0x13900081, 0x13900083, 0x1390008a, - 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, - 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, - 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, - 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, - 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, - // Entry C0 - DF - 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, - 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, - 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, - 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, - 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, - 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, - 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, - 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, - // Entry E0 - FF - 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, - 0x13900131, 0x13900133, 0x13900135, 0x13900139, - 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, - 0x13900161, 0x13900162, 0x13900164, 0x13c00000, - 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, - 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, - 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, - 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, - // Entry 100 - 11F - 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, - 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, - 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, - 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, - 0x14500000, 0x1450006e, 0x14600000, 0x14600052, - 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, - 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, - 0x15100000, 0x15100072, 0x15300000, 0x153000e7, - // Entry 120 - 13F - 0x15800000, 0x15800063, 0x15800076, 0x15e00000, - 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, - 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, - 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, - 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, - 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, - 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, - 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, - // Entry 140 - 15F - 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, - 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, - 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, - 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, - 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, - 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, - 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, - 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, - // Entry 160 - 17F - 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, - 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, - 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, - 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, - 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, - 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, - 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, - 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, - // Entry 180 - 19F - 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, - 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, - 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, - 0x200000a2, 0x20300000, 0x20700000, 0x20700052, - 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, - 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, - 0x21200067, 0x21600000, 0x21700000, 0x217000a4, - 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, - // Entry 1A0 - 1BF - 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, - 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, - 0x24400052, 0x24500000, 0x24500082, 0x24600000, - 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, - 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, - 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, - 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, - 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, - // Entry 1C0 - 1DF - 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, - 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, - 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, - 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, - 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, - 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, - 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, - 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, - // Entry 1E0 - 1FF - 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, - 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, - 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, - 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, - 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, - 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, - 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, - 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, - // Entry 200 - 21F - 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, - 0x34700000, 0x347000da, 0x34700110, 0x34e00000, - 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, - 0x35100000, 0x35100099, 0x351000db, 0x36700000, - 0x36700030, 0x36700036, 0x36700040, 0x3670005b, - 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, - 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, - 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, - // Entry 220 - 23F - 0x37a00000, 0x38000000, 0x38000117, 0x38700000, - 0x38900000, 0x38900131, 0x39000000, 0x3900006f, - 0x390000a4, 0x39500000, 0x39500099, 0x39800000, - 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, - 0x39d050e8, 0x39d33000, 0x39d33099, 0x3a100000, - 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, - 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, - 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, - // Entry 240 - 25F - 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, - 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, - 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, - 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, - 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, - 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, - 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, - 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, - // Entry 260 - 27F - 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, - 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, - 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, - 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, - 0x40200000, 0x4020004c, 0x40700000, 0x40800000, - 0x40857000, 0x408570ba, 0x408dc000, 0x408dc0ba, - 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, - 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, - // Entry 280 - 29F - 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, - 0x42300000, 0x42300164, 0x42900000, 0x42900062, - 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, - 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, - 0x4321f000, 0x4321f033, 0x4321f0bd, 0x4321f105, - 0x4321f14d, 0x43257000, 0x43257033, 0x432570bd, - 0x43257105, 0x4325714d, 0x43700000, 0x43a00000, - 0x43b00000, 0x44400000, 0x44400031, 0x44400072, - // Entry 2A0 - 2BF - 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, - 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, - 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, - 0x46100000, 0x46100099, 0x46400000, 0x464000a4, - 0x46400131, 0x46700000, 0x46700124, 0x46b00000, - 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, - 0x47100000, 0x47600000, 0x47600127, 0x47a00000, - 0x48000000, 0x48200000, 0x48200129, 0x48a00000, - // Entry 2C0 - 2DF - 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, - 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, - 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, - 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, - 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc1f000, - 0x4bc1f137, 0x4bc57000, 0x4bc57137, 0x4be00000, - 0x4be57000, 0x4be570b4, 0x4bee3000, 0x4bee30b4, - 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, - // Entry 2E0 - 2FF - 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, - 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, - 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, - 0x50900052, 0x51200000, 0x51200001, 0x51800000, - 0x5180003b, 0x518000d6, 0x51f00000, 0x51f38000, - 0x51f38053, 0x51f39000, 0x51f3908d, 0x52800000, - 0x528000ba, 0x52900000, 0x52938000, 0x52938053, - 0x5293808d, 0x529380c6, 0x5293810d, 0x52939000, - // Entry 300 - 31F - 0x5293908d, 0x529390c6, 0x5293912e, 0x52f00000, - 0x52f00161, -} // Size: 3116 bytes - -const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" - -// Total table size 3147 bytes (3KiB); checksum: F4E57D15 diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go deleted file mode 100644 index ca135d29..00000000 --- a/vendor/golang.org/x/text/internal/language/compact/tags.go +++ /dev/null @@ -1,91 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package compact - -var ( - und = Tag{} - - Und Tag = Tag{} - - Afrikaans Tag = Tag{language: afIndex, locale: afIndex} - Amharic Tag = Tag{language: amIndex, locale: amIndex} - Arabic Tag = Tag{language: arIndex, locale: arIndex} - ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index} - Azerbaijani Tag = Tag{language: azIndex, locale: azIndex} - Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex} - Bengali Tag = Tag{language: bnIndex, locale: bnIndex} - Catalan Tag = Tag{language: caIndex, locale: caIndex} - Czech Tag = Tag{language: csIndex, locale: csIndex} - Danish Tag = Tag{language: daIndex, locale: daIndex} - German Tag = Tag{language: deIndex, locale: deIndex} - Greek Tag = Tag{language: elIndex, locale: elIndex} - English Tag = Tag{language: enIndex, locale: enIndex} - AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex} - BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex} - Spanish Tag = Tag{language: esIndex, locale: esIndex} - EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex} - LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index} - Estonian Tag = Tag{language: etIndex, locale: etIndex} - Persian Tag = Tag{language: faIndex, locale: faIndex} - Finnish Tag = Tag{language: fiIndex, locale: fiIndex} - Filipino Tag = Tag{language: filIndex, locale: filIndex} - French Tag = Tag{language: frIndex, locale: frIndex} - CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex} - Gujarati Tag = Tag{language: guIndex, locale: guIndex} - Hebrew Tag = Tag{language: heIndex, locale: heIndex} - Hindi Tag = Tag{language: hiIndex, locale: hiIndex} - Croatian Tag = Tag{language: hrIndex, locale: hrIndex} - Hungarian Tag = Tag{language: huIndex, locale: huIndex} - Armenian Tag = Tag{language: hyIndex, locale: hyIndex} - Indonesian Tag = Tag{language: idIndex, locale: idIndex} - Icelandic Tag = Tag{language: isIndex, locale: isIndex} - Italian Tag = Tag{language: itIndex, locale: itIndex} - Japanese Tag = Tag{language: jaIndex, locale: jaIndex} - Georgian Tag = Tag{language: kaIndex, locale: kaIndex} - Kazakh Tag = Tag{language: kkIndex, locale: kkIndex} - Khmer Tag = Tag{language: kmIndex, locale: kmIndex} - Kannada Tag = Tag{language: knIndex, locale: knIndex} - Korean Tag = Tag{language: koIndex, locale: koIndex} - Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex} - Lao Tag = Tag{language: loIndex, locale: loIndex} - Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex} - Latvian Tag = Tag{language: lvIndex, locale: lvIndex} - Macedonian Tag = Tag{language: mkIndex, locale: mkIndex} - Malayalam Tag = Tag{language: mlIndex, locale: mlIndex} - Mongolian Tag = Tag{language: mnIndex, locale: mnIndex} - Marathi Tag = Tag{language: mrIndex, locale: mrIndex} - Malay Tag = Tag{language: msIndex, locale: msIndex} - Burmese Tag = Tag{language: myIndex, locale: myIndex} - Nepali Tag = Tag{language: neIndex, locale: neIndex} - Dutch Tag = Tag{language: nlIndex, locale: nlIndex} - Norwegian Tag = Tag{language: noIndex, locale: noIndex} - Punjabi Tag = Tag{language: paIndex, locale: paIndex} - Polish Tag = Tag{language: plIndex, locale: plIndex} - Portuguese Tag = Tag{language: ptIndex, locale: ptIndex} - BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex} - EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex} - Romanian Tag = Tag{language: roIndex, locale: roIndex} - Russian Tag = Tag{language: ruIndex, locale: ruIndex} - Sinhala Tag = Tag{language: siIndex, locale: siIndex} - Slovak Tag = Tag{language: skIndex, locale: skIndex} - Slovenian Tag = Tag{language: slIndex, locale: slIndex} - Albanian Tag = Tag{language: sqIndex, locale: sqIndex} - Serbian Tag = Tag{language: srIndex, locale: srIndex} - SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex} - Swedish Tag = Tag{language: svIndex, locale: svIndex} - Swahili Tag = Tag{language: swIndex, locale: swIndex} - Tamil Tag = Tag{language: taIndex, locale: taIndex} - Telugu Tag = Tag{language: teIndex, locale: teIndex} - Thai Tag = Tag{language: thIndex, locale: thIndex} - Turkish Tag = Tag{language: trIndex, locale: trIndex} - Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex} - Urdu Tag = Tag{language: urIndex, locale: urIndex} - Uzbek Tag = Tag{language: uzIndex, locale: uzIndex} - Vietnamese Tag = Tag{language: viIndex, locale: viIndex} - Chinese Tag = Tag{language: zhIndex, locale: zhIndex} - SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex} - TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex} - Zulu Tag = Tag{language: zuIndex, locale: zuIndex} -) diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go deleted file mode 100644 index 4ae78e0f..00000000 --- a/vendor/golang.org/x/text/internal/language/compose.go +++ /dev/null @@ -1,167 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "sort" - "strings" -) - -// A Builder allows constructing a Tag from individual components. -// Its main user is Compose in the top-level language package. -type Builder struct { - Tag Tag - - private string // the x extension - variants []string - extensions []string -} - -// Make returns a new Tag from the current settings. -func (b *Builder) Make() Tag { - t := b.Tag - - if len(b.extensions) > 0 || len(b.variants) > 0 { - sort.Sort(sortVariants(b.variants)) - sort.Strings(b.extensions) - - if b.private != "" { - b.extensions = append(b.extensions, b.private) - } - n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...) - buf := make([]byte, n) - p := t.genCoreBytes(buf) - t.pVariant = byte(p) - p += appendTokens(buf[p:], b.variants...) - t.pExt = uint16(p) - p += appendTokens(buf[p:], b.extensions...) - t.str = string(buf[:p]) - // We may not always need to remake the string, but when or when not - // to do so is rather tricky. - scan := makeScanner(buf[:p]) - t, _ = parse(&scan, "") - return t - - } else if b.private != "" { - t.str = b.private - t.RemakeString() - } - return t -} - -// SetTag copies all the settings from a given Tag. Any previously set values -// are discarded. -func (b *Builder) SetTag(t Tag) { - b.Tag.LangID = t.LangID - b.Tag.RegionID = t.RegionID - b.Tag.ScriptID = t.ScriptID - // TODO: optimize - b.variants = b.variants[:0] - if variants := t.Variants(); variants != "" { - for _, vr := range strings.Split(variants[1:], "-") { - b.variants = append(b.variants, vr) - } - } - b.extensions, b.private = b.extensions[:0], "" - for _, e := range t.Extensions() { - b.AddExt(e) - } -} - -// AddExt adds extension e to the tag. e must be a valid extension as returned -// by Tag.Extension. If the extension already exists, it will be discarded, -// except for a -u extension, where non-existing key-type pairs will added. -func (b *Builder) AddExt(e string) { - if e[0] == 'x' { - if b.private == "" { - b.private = e - } - return - } - for i, s := range b.extensions { - if s[0] == e[0] { - if e[0] == 'u' { - b.extensions[i] += e[1:] - } - return - } - } - b.extensions = append(b.extensions, e) -} - -// SetExt sets the extension e to the tag. e must be a valid extension as -// returned by Tag.Extension. If the extension already exists, it will be -// overwritten, except for a -u extension, where the individual key-type pairs -// will be set. -func (b *Builder) SetExt(e string) { - if e[0] == 'x' { - b.private = e - return - } - for i, s := range b.extensions { - if s[0] == e[0] { - if e[0] == 'u' { - b.extensions[i] = e + s[1:] - } else { - b.extensions[i] = e - } - return - } - } - b.extensions = append(b.extensions, e) -} - -// AddVariant adds any number of variants. -func (b *Builder) AddVariant(v ...string) { - for _, v := range v { - if v != "" { - b.variants = append(b.variants, v) - } - } -} - -// ClearVariants removes any variants previously added, including those -// copied from a Tag in SetTag. -func (b *Builder) ClearVariants() { - b.variants = b.variants[:0] -} - -// ClearExtensions removes any extensions previously added, including those -// copied from a Tag in SetTag. -func (b *Builder) ClearExtensions() { - b.private = "" - b.extensions = b.extensions[:0] -} - -func tokenLen(token ...string) (n int) { - for _, t := range token { - n += len(t) + 1 - } - return -} - -func appendTokens(b []byte, token ...string) int { - p := 0 - for _, t := range token { - b[p] = '-' - copy(b[p+1:], t) - p += 1 + len(t) - } - return p -} - -type sortVariants []string - -func (s sortVariants) Len() int { - return len(s) -} - -func (s sortVariants) Swap(i, j int) { - s[j], s[i] = s[i], s[j] -} - -func (s sortVariants) Less(i, j int) bool { - return variantIndex[s[i]] < variantIndex[s[j]] -} diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go deleted file mode 100644 index 9b20b88f..00000000 --- a/vendor/golang.org/x/text/internal/language/coverage.go +++ /dev/null @@ -1,28 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -// BaseLanguages returns the list of all supported base languages. It generates -// the list by traversing the internal structures. -func BaseLanguages() []Language { - base := make([]Language, 0, NumLanguages) - for i := 0; i < langNoIndexOffset; i++ { - // We included "und" already for the value 0. - if i != nonCanonicalUnd { - base = append(base, Language(i)) - } - } - i := langNoIndexOffset - for _, v := range langNoIndex { - for k := 0; k < 8; k++ { - if v&1 == 1 { - base = append(base, Language(i)) - } - v >>= 1 - i++ - } - } - return base -} diff --git a/vendor/golang.org/x/text/internal/language/gen.go b/vendor/golang.org/x/text/internal/language/gen.go deleted file mode 100644 index cdcc7feb..00000000 --- a/vendor/golang.org/x/text/internal/language/gen.go +++ /dev/null @@ -1,1520 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -// Language tag table generator. -// Data read from the web. - -package main - -import ( - "bufio" - "flag" - "fmt" - "io" - "io/ioutil" - "log" - "math" - "reflect" - "regexp" - "sort" - "strconv" - "strings" - - "golang.org/x/text/internal/gen" - "golang.org/x/text/internal/tag" - "golang.org/x/text/unicode/cldr" -) - -var ( - test = flag.Bool("test", - false, - "test existing tables; can be used to compare web data with package data.") - outputFile = flag.String("output", - "tables.go", - "output file for generated tables") -) - -var comment = []string{ - ` -lang holds an alphabetically sorted list of ISO-639 language identifiers. -All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. -For 2-byte language identifiers, the two successive bytes have the following meaning: - - if the first letter of the 2- and 3-letter ISO codes are the same: - the second and third letter of the 3-letter ISO code. - - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. -For 3-byte language identifiers the 4th byte is 0.`, - ` -langNoIndex is a bit vector of all 3-letter language codes that are not used as an index -in lookup tables. The language ids for these language codes are derived directly -from the letters and are not consecutive.`, - ` -altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives -to 2-letter language codes that cannot be derived using the method described above. -Each 3-letter code is followed by its 1-byte langID.`, - ` -altLangIndex is used to convert indexes in altLangISO3 to langIDs.`, - ` -AliasMap maps langIDs to their suggested replacements.`, - ` -script is an alphabetically sorted list of ISO 15924 codes. The index -of the script in the string, divided by 4, is the internal scriptID.`, - ` -isoRegionOffset needs to be added to the index of regionISO to obtain the regionID -for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for -the UN.M49 codes used for groups.)`, - ` -regionISO holds a list of alphabetically sorted 2-letter ISO region codes. -Each 2-letter codes is followed by two bytes with the following meaning: - - [A-Z}{2}: the first letter of the 2-letter code plus these two - letters form the 3-letter ISO code. - - 0, n: index into altRegionISO3.`, - ` -regionTypes defines the status of a region for various standards.`, - ` -m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are -codes indicating collections of regions.`, - ` -m49Index gives indexes into fromM49 based on the three most significant bits -of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in - fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] -for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. -The region code is stored in the 9 lsb of the indexed value.`, - ` -fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`, - ` -altRegionISO3 holds a list of 3-letter region codes that cannot be -mapped to 2-letter codes using the default algorithm. This is a short list.`, - ` -altRegionIDs holds a list of regionIDs the positions of which match those -of the 3-letter ISO codes in altRegionISO3.`, - ` -variantNumSpecialized is the number of specialized variants in variants.`, - ` -suppressScript is an index from langID to the dominant script for that language, -if it exists. If a script is given, it should be suppressed from the language tag.`, - ` -likelyLang is a lookup table, indexed by langID, for the most likely -scripts and regions given incomplete information. If more entries exist for a -given language, region and script are the index and size respectively -of the list in likelyLangList.`, - ` -likelyLangList holds lists info associated with likelyLang.`, - ` -likelyRegion is a lookup table, indexed by regionID, for the most likely -languages and scripts given incomplete information. If more entries exist -for a given regionID, lang and script are the index and size respectively -of the list in likelyRegionList. -TODO: exclude containers and user-definable regions from the list.`, - ` -likelyRegionList holds lists info associated with likelyRegion.`, - ` -likelyScript is a lookup table, indexed by scriptID, for the most likely -languages and regions given a script.`, - ` -nRegionGroups is the number of region groups.`, - ` -regionInclusion maps region identifiers to sets of regions in regionInclusionBits, -where each set holds all groupings that are directly connected in a region -containment graph.`, - ` -regionInclusionBits is an array of bit vectors where every vector represents -a set of region groupings. These sets are used to compute the distance -between two regions for the purpose of language matching.`, - ` -regionInclusionNext marks, for each entry in regionInclusionBits, the set of -all groups that are reachable from the groups set in the respective entry.`, -} - -// TODO: consider changing some of these structures to tries. This can reduce -// memory, but may increase the need for memory allocations. This could be -// mitigated if we can piggyback on language tags for common cases. - -func failOnError(e error) { - if e != nil { - log.Panic(e) - } -} - -type setType int - -const ( - Indexed setType = 1 + iota // all elements must be of same size - Linear -) - -type stringSet struct { - s []string - sorted, frozen bool - - // We often need to update values after the creation of an index is completed. - // We include a convenience map for keeping track of this. - update map[string]string - typ setType // used for checking. -} - -func (ss *stringSet) clone() stringSet { - c := *ss - c.s = append([]string(nil), c.s...) - return c -} - -func (ss *stringSet) setType(t setType) { - if ss.typ != t && ss.typ != 0 { - log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ) - } -} - -// parse parses a whitespace-separated string and initializes ss with its -// components. -func (ss *stringSet) parse(s string) { - scan := bufio.NewScanner(strings.NewReader(s)) - scan.Split(bufio.ScanWords) - for scan.Scan() { - ss.add(scan.Text()) - } -} - -func (ss *stringSet) assertChangeable() { - if ss.frozen { - log.Panic("attempt to modify a frozen stringSet") - } -} - -func (ss *stringSet) add(s string) { - ss.assertChangeable() - ss.s = append(ss.s, s) - ss.sorted = ss.frozen -} - -func (ss *stringSet) freeze() { - ss.compact() - ss.frozen = true -} - -func (ss *stringSet) compact() { - if ss.sorted { - return - } - a := ss.s - sort.Strings(a) - k := 0 - for i := 1; i < len(a); i++ { - if a[k] != a[i] { - a[k+1] = a[i] - k++ - } - } - ss.s = a[:k+1] - ss.sorted = ss.frozen -} - -type funcSorter struct { - fn func(a, b string) bool - sort.StringSlice -} - -func (s funcSorter) Less(i, j int) bool { - return s.fn(s.StringSlice[i], s.StringSlice[j]) -} - -func (ss *stringSet) sortFunc(f func(a, b string) bool) { - ss.compact() - sort.Sort(funcSorter{f, sort.StringSlice(ss.s)}) -} - -func (ss *stringSet) remove(s string) { - ss.assertChangeable() - if i, ok := ss.find(s); ok { - copy(ss.s[i:], ss.s[i+1:]) - ss.s = ss.s[:len(ss.s)-1] - } -} - -func (ss *stringSet) replace(ol, nu string) { - ss.s[ss.index(ol)] = nu - ss.sorted = ss.frozen -} - -func (ss *stringSet) index(s string) int { - ss.setType(Indexed) - i, ok := ss.find(s) - if !ok { - if i < len(ss.s) { - log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i]) - } - log.Panicf("find: item %q is not in list", s) - - } - return i -} - -func (ss *stringSet) find(s string) (int, bool) { - ss.compact() - i := sort.SearchStrings(ss.s, s) - return i, i != len(ss.s) && ss.s[i] == s -} - -func (ss *stringSet) slice() []string { - ss.compact() - return ss.s -} - -func (ss *stringSet) updateLater(v, key string) { - if ss.update == nil { - ss.update = map[string]string{} - } - ss.update[v] = key -} - -// join joins the string and ensures that all entries are of the same length. -func (ss *stringSet) join() string { - ss.setType(Indexed) - n := len(ss.s[0]) - for _, s := range ss.s { - if len(s) != n { - log.Panicf("join: not all entries are of the same length: %q", s) - } - } - ss.s = append(ss.s, strings.Repeat("\xff", n)) - return strings.Join(ss.s, "") -} - -// ianaEntry holds information for an entry in the IANA Language Subtag Repository. -// All types use the same entry. -// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various -// fields. -type ianaEntry struct { - typ string - description []string - scope string - added string - preferred string - deprecated string - suppressScript string - macro string - prefix []string -} - -type builder struct { - w *gen.CodeWriter - hw io.Writer // MultiWriter for w and w.Hash - data *cldr.CLDR - supp *cldr.SupplementalData - - // indices - locale stringSet // common locales - lang stringSet // canonical language ids (2 or 3 letter ISO codes) with data - langNoIndex stringSet // 3-letter ISO codes with no associated data - script stringSet // 4-letter ISO codes - region stringSet // 2-letter ISO or 3-digit UN M49 codes - variant stringSet // 4-8-alphanumeric variant code. - - // Region codes that are groups with their corresponding group IDs. - groups map[int]index - - // langInfo - registry map[string]*ianaEntry -} - -type index uint - -func newBuilder(w *gen.CodeWriter) *builder { - r := gen.OpenCLDRCoreZip() - defer r.Close() - d := &cldr.Decoder{} - data, err := d.DecodeZip(r) - failOnError(err) - b := builder{ - w: w, - hw: io.MultiWriter(w, w.Hash), - data: data, - supp: data.Supplemental(), - } - b.parseRegistry() - return &b -} - -func (b *builder) parseRegistry() { - r := gen.OpenIANAFile("assignments/language-subtag-registry") - defer r.Close() - b.registry = make(map[string]*ianaEntry) - - scan := bufio.NewScanner(r) - scan.Split(bufio.ScanWords) - var record *ianaEntry - for more := scan.Scan(); more; { - key := scan.Text() - more = scan.Scan() - value := scan.Text() - switch key { - case "Type:": - record = &ianaEntry{typ: value} - case "Subtag:", "Tag:": - if s := strings.SplitN(value, "..", 2); len(s) > 1 { - for a := s[0]; a <= s[1]; a = inc(a) { - b.addToRegistry(a, record) - } - } else { - b.addToRegistry(value, record) - } - case "Suppress-Script:": - record.suppressScript = value - case "Added:": - record.added = value - case "Deprecated:": - record.deprecated = value - case "Macrolanguage:": - record.macro = value - case "Preferred-Value:": - record.preferred = value - case "Prefix:": - record.prefix = append(record.prefix, value) - case "Scope:": - record.scope = value - case "Description:": - buf := []byte(value) - for more = scan.Scan(); more; more = scan.Scan() { - b := scan.Bytes() - if b[0] == '%' || b[len(b)-1] == ':' { - break - } - buf = append(buf, ' ') - buf = append(buf, b...) - } - record.description = append(record.description, string(buf)) - continue - default: - continue - } - more = scan.Scan() - } - if scan.Err() != nil { - log.Panic(scan.Err()) - } -} - -func (b *builder) addToRegistry(key string, entry *ianaEntry) { - if info, ok := b.registry[key]; ok { - if info.typ != "language" || entry.typ != "extlang" { - log.Fatalf("parseRegistry: tag %q already exists", key) - } - } else { - b.registry[key] = entry - } -} - -var commentIndex = make(map[string]string) - -func init() { - for _, s := range comment { - key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0]) - commentIndex[key] = s - } -} - -func (b *builder) comment(name string) { - if s := commentIndex[name]; len(s) > 0 { - b.w.WriteComment(s) - } else { - fmt.Fprintln(b.w) - } -} - -func (b *builder) pf(f string, x ...interface{}) { - fmt.Fprintf(b.hw, f, x...) - fmt.Fprint(b.hw, "\n") -} - -func (b *builder) p(x ...interface{}) { - fmt.Fprintln(b.hw, x...) -} - -func (b *builder) addSize(s int) { - b.w.Size += s - b.pf("// Size: %d bytes", s) -} - -func (b *builder) writeConst(name string, x interface{}) { - b.comment(name) - b.w.WriteConst(name, x) -} - -// writeConsts computes f(v) for all v in values and writes the results -// as constants named _v to a single constant block. -func (b *builder) writeConsts(f func(string) int, values ...string) { - b.pf("const (") - for _, v := range values { - b.pf("\t_%s = %v", v, f(v)) - } - b.pf(")") -} - -// writeType writes the type of the given value, which must be a struct. -func (b *builder) writeType(value interface{}) { - b.comment(reflect.TypeOf(value).Name()) - b.w.WriteType(value) -} - -func (b *builder) writeSlice(name string, ss interface{}) { - b.writeSliceAddSize(name, 0, ss) -} - -func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) { - b.comment(name) - b.w.Size += extraSize - v := reflect.ValueOf(ss) - t := v.Type().Elem() - b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len()) - - fmt.Fprintf(b.w, "var %s = ", name) - b.w.WriteArray(ss) - b.p() -} - -type FromTo struct { - From, To uint16 -} - -func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) { - ss.sortFunc(func(a, b string) bool { - return index(a) < index(b) - }) - m := []FromTo{} - for _, s := range ss.s { - m = append(m, FromTo{index(s), index(ss.update[s])}) - } - b.writeSlice(name, m) -} - -const base = 'z' - 'a' + 1 - -func strToInt(s string) uint { - v := uint(0) - for i := 0; i < len(s); i++ { - v *= base - v += uint(s[i] - 'a') - } - return v -} - -// converts the given integer to the original ASCII string passed to strToInt. -// len(s) must match the number of characters obtained. -func intToStr(v uint, s []byte) { - for i := len(s) - 1; i >= 0; i-- { - s[i] = byte(v%base) + 'a' - v /= base - } -} - -func (b *builder) writeBitVector(name string, ss []string) { - vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8))) - for _, s := range ss { - v := strToInt(s) - vec[v/8] |= 1 << (v % 8) - } - b.writeSlice(name, vec) -} - -// TODO: convert this type into a list or two-stage trie. -func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) { - b.comment(name) - v := reflect.ValueOf(m) - sz := v.Len() * (2 + int(v.Type().Key().Size())) - for _, k := range m { - sz += len(k) - } - b.addSize(sz) - keys := []string{} - b.pf(`var %s = map[string]uint16{`, name) - for k := range m { - keys = append(keys, k) - } - sort.Strings(keys) - for _, k := range keys { - b.pf("\t%q: %v,", k, f(m[k])) - } - b.p("}") -} - -func (b *builder) writeMap(name string, m interface{}) { - b.comment(name) - v := reflect.ValueOf(m) - sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size())) - b.addSize(sz) - f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool { - return strings.IndexRune("{}, ", r) != -1 - }) - sort.Strings(f[1:]) - b.pf(`var %s = %s{`, name, f[0]) - for _, kv := range f[1:] { - b.pf("\t%s,", kv) - } - b.p("}") -} - -func (b *builder) langIndex(s string) uint16 { - if s == "und" { - return 0 - } - if i, ok := b.lang.find(s); ok { - return uint16(i) - } - return uint16(strToInt(s)) + uint16(len(b.lang.s)) -} - -// inc advances the string to its lexicographical successor. -func inc(s string) string { - const maxTagLength = 4 - var buf [maxTagLength]byte - intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)]) - for i := 0; i < len(s); i++ { - if s[i] <= 'Z' { - buf[i] -= 'a' - 'A' - } - } - return string(buf[:len(s)]) -} - -func (b *builder) parseIndices() { - meta := b.supp.Metadata - - for k, v := range b.registry { - var ss *stringSet - switch v.typ { - case "language": - if len(k) == 2 || v.suppressScript != "" || v.scope == "special" { - b.lang.add(k) - continue - } else { - ss = &b.langNoIndex - } - case "region": - ss = &b.region - case "script": - ss = &b.script - case "variant": - ss = &b.variant - default: - continue - } - ss.add(k) - } - // Include any language for which there is data. - for _, lang := range b.data.Locales() { - if x := b.data.RawLDML(lang); false || - x.LocaleDisplayNames != nil || - x.Characters != nil || - x.Delimiters != nil || - x.Measurement != nil || - x.Dates != nil || - x.Numbers != nil || - x.Units != nil || - x.ListPatterns != nil || - x.Collations != nil || - x.Segmentations != nil || - x.Rbnf != nil || - x.Annotations != nil || - x.Metadata != nil { - - from := strings.Split(lang, "_") - if lang := from[0]; lang != "root" { - b.lang.add(lang) - } - } - } - // Include locales for plural rules, which uses a different structure. - for _, plurals := range b.data.Supplemental().Plurals { - for _, rules := range plurals.PluralRules { - for _, lang := range strings.Split(rules.Locales, " ") { - if lang = strings.Split(lang, "_")[0]; lang != "root" { - b.lang.add(lang) - } - } - } - } - // Include languages in likely subtags. - for _, m := range b.supp.LikelySubtags.LikelySubtag { - from := strings.Split(m.From, "_") - b.lang.add(from[0]) - } - // Include ISO-639 alpha-3 bibliographic entries. - for _, a := range meta.Alias.LanguageAlias { - if a.Reason == "bibliographic" { - b.langNoIndex.add(a.Type) - } - } - // Include regions in territoryAlias (not all are in the IANA registry!) - for _, reg := range b.supp.Metadata.Alias.TerritoryAlias { - if len(reg.Type) == 2 { - b.region.add(reg.Type) - } - } - - for _, s := range b.lang.s { - if len(s) == 3 { - b.langNoIndex.remove(s) - } - } - b.writeConst("NumLanguages", len(b.lang.slice())+len(b.langNoIndex.slice())) - b.writeConst("NumScripts", len(b.script.slice())) - b.writeConst("NumRegions", len(b.region.slice())) - - // Add dummy codes at the start of each list to represent "unspecified". - b.lang.add("---") - b.script.add("----") - b.region.add("---") - - // common locales - b.locale.parse(meta.DefaultContent.Locales) -} - -// TODO: region inclusion data will probably not be use used in future matchers. - -func (b *builder) computeRegionGroups() { - b.groups = make(map[int]index) - - // Create group indices. - for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID. - b.groups[i] = index(len(b.groups)) - } - for _, g := range b.supp.TerritoryContainment.Group { - // Skip UN and EURO zone as they are flattening the containment - // relationship. - if g.Type == "EZ" || g.Type == "UN" { - continue - } - group := b.region.index(g.Type) - if _, ok := b.groups[group]; !ok { - b.groups[group] = index(len(b.groups)) - } - } - if len(b.groups) > 64 { - log.Fatalf("only 64 groups supported, found %d", len(b.groups)) - } - b.writeConst("nRegionGroups", len(b.groups)) -} - -var langConsts = []string{ - "af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es", - "et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is", - "it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml", - "mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt", - "ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th", - "tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu", - - // constants for grandfathered tags (if not already defined) - "jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu", - "nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn", -} - -// writeLanguage generates all tables needed for language canonicalization. -func (b *builder) writeLanguage() { - meta := b.supp.Metadata - - b.writeConst("nonCanonicalUnd", b.lang.index("und")) - b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...) - b.writeConst("langPrivateStart", b.langIndex("qaa")) - b.writeConst("langPrivateEnd", b.langIndex("qtz")) - - // Get language codes that need to be mapped (overlong 3-letter codes, - // deprecated 2-letter codes, legacy and grandfathered tags.) - langAliasMap := stringSet{} - aliasTypeMap := map[string]AliasType{} - - // altLangISO3 get the alternative ISO3 names that need to be mapped. - altLangISO3 := stringSet{} - // Add dummy start to avoid the use of index 0. - altLangISO3.add("---") - altLangISO3.updateLater("---", "aa") - - lang := b.lang.clone() - for _, a := range meta.Alias.LanguageAlias { - if a.Replacement == "" { - a.Replacement = "und" - } - // TODO: support mapping to tags - repl := strings.SplitN(a.Replacement, "_", 2)[0] - if a.Reason == "overlong" { - if len(a.Replacement) == 2 && len(a.Type) == 3 { - lang.updateLater(a.Replacement, a.Type) - } - } else if len(a.Type) <= 3 { - switch a.Reason { - case "macrolanguage": - aliasTypeMap[a.Type] = Macro - case "deprecated": - // handled elsewhere - continue - case "bibliographic", "legacy": - if a.Type == "no" { - continue - } - aliasTypeMap[a.Type] = Legacy - default: - log.Fatalf("new %s alias: %s", a.Reason, a.Type) - } - langAliasMap.add(a.Type) - langAliasMap.updateLater(a.Type, repl) - } - } - // Manually add the mapping of "nb" (Norwegian) to its macro language. - // This can be removed if CLDR adopts this change. - langAliasMap.add("nb") - langAliasMap.updateLater("nb", "no") - aliasTypeMap["nb"] = Macro - - for k, v := range b.registry { - // Also add deprecated values for 3-letter ISO codes, which CLDR omits. - if v.typ == "language" && v.deprecated != "" && v.preferred != "" { - langAliasMap.add(k) - langAliasMap.updateLater(k, v.preferred) - aliasTypeMap[k] = Deprecated - } - } - // Fix CLDR mappings. - lang.updateLater("tl", "tgl") - lang.updateLater("sh", "hbs") - lang.updateLater("mo", "mol") - lang.updateLater("no", "nor") - lang.updateLater("tw", "twi") - lang.updateLater("nb", "nob") - lang.updateLater("ak", "aka") - lang.updateLater("bh", "bih") - - // Ensure that each 2-letter code is matched with a 3-letter code. - for _, v := range lang.s[1:] { - s, ok := lang.update[v] - if !ok { - if s, ok = lang.update[langAliasMap.update[v]]; !ok { - continue - } - lang.update[v] = s - } - if v[0] != s[0] { - altLangISO3.add(s) - altLangISO3.updateLater(s, v) - } - } - - // Complete canonicalized language tags. - lang.freeze() - for i, v := range lang.s { - // We can avoid these manual entries by using the IANA registry directly. - // Seems easier to update the list manually, as changes are rare. - // The panic in this loop will trigger if we miss an entry. - add := "" - if s, ok := lang.update[v]; ok { - if s[0] == v[0] { - add = s[1:] - } else { - add = string([]byte{0, byte(altLangISO3.index(s))}) - } - } else if len(v) == 3 { - add = "\x00" - } else { - log.Panicf("no data for long form of %q", v) - } - lang.s[i] += add - } - b.writeConst("lang", tag.Index(lang.join())) - - b.writeConst("langNoIndexOffset", len(b.lang.s)) - - // space of all valid 3-letter language identifiers. - b.writeBitVector("langNoIndex", b.langNoIndex.slice()) - - altLangIndex := []uint16{} - for i, s := range altLangISO3.slice() { - altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))}) - if i > 0 { - idx := b.lang.index(altLangISO3.update[s]) - altLangIndex = append(altLangIndex, uint16(idx)) - } - } - b.writeConst("altLangISO3", tag.Index(altLangISO3.join())) - b.writeSlice("altLangIndex", altLangIndex) - - b.writeSortedMap("AliasMap", &langAliasMap, b.langIndex) - types := make([]AliasType, len(langAliasMap.s)) - for i, s := range langAliasMap.s { - types[i] = aliasTypeMap[s] - } - b.writeSlice("AliasTypes", types) -} - -var scriptConsts = []string{ - "Latn", "Hani", "Hans", "Hant", "Qaaa", "Qaai", "Qabx", "Zinh", "Zyyy", - "Zzzz", -} - -func (b *builder) writeScript() { - b.writeConsts(b.script.index, scriptConsts...) - b.writeConst("script", tag.Index(b.script.join())) - - supp := make([]uint8, len(b.lang.slice())) - for i, v := range b.lang.slice()[1:] { - if sc := b.registry[v].suppressScript; sc != "" { - supp[i+1] = uint8(b.script.index(sc)) - } - } - b.writeSlice("suppressScript", supp) - - // There is only one deprecated script in CLDR. This value is hard-coded. - // We check here if the code must be updated. - for _, a := range b.supp.Metadata.Alias.ScriptAlias { - if a.Type != "Qaai" { - log.Panicf("unexpected deprecated stript %q", a.Type) - } - } -} - -func parseM49(s string) int16 { - if len(s) == 0 { - return 0 - } - v, err := strconv.ParseUint(s, 10, 10) - failOnError(err) - return int16(v) -} - -var regionConsts = []string{ - "001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US", - "ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo. -} - -func (b *builder) writeRegion() { - b.writeConsts(b.region.index, regionConsts...) - - isoOffset := b.region.index("AA") - m49map := make([]int16, len(b.region.slice())) - fromM49map := make(map[int16]int) - altRegionISO3 := "" - altRegionIDs := []uint16{} - - b.writeConst("isoRegionOffset", isoOffset) - - // 2-letter region lookup and mapping to numeric codes. - regionISO := b.region.clone() - regionISO.s = regionISO.s[isoOffset:] - regionISO.sorted = false - - regionTypes := make([]byte, len(b.region.s)) - - // Is the region valid BCP 47? - for s, e := range b.registry { - if len(s) == 2 && s == strings.ToUpper(s) { - i := b.region.index(s) - for _, d := range e.description { - if strings.Contains(d, "Private use") { - regionTypes[i] = iso3166UserAssigned - } - } - regionTypes[i] |= bcp47Region - } - } - - // Is the region a valid ccTLD? - r := gen.OpenIANAFile("domains/root/db") - defer r.Close() - - buf, err := ioutil.ReadAll(r) - failOnError(err) - re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`) - for _, m := range re.FindAllSubmatch(buf, -1) { - i := b.region.index(strings.ToUpper(string(m[1]))) - regionTypes[i] |= ccTLD - } - - b.writeSlice("regionTypes", regionTypes) - - iso3Set := make(map[string]int) - update := func(iso2, iso3 string) { - i := regionISO.index(iso2) - if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] { - regionISO.s[i] += iso3[1:] - iso3Set[iso3] = -1 - } else { - if ok && j >= 0 { - regionISO.s[i] += string([]byte{0, byte(j)}) - } else { - iso3Set[iso3] = len(altRegionISO3) - regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))}) - altRegionISO3 += iso3 - altRegionIDs = append(altRegionIDs, uint16(isoOffset+i)) - } - } - } - for _, tc := range b.supp.CodeMappings.TerritoryCodes { - i := regionISO.index(tc.Type) + isoOffset - if d := m49map[i]; d != 0 { - log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d) - } - m49 := parseM49(tc.Numeric) - m49map[i] = m49 - if r := fromM49map[m49]; r == 0 { - fromM49map[m49] = i - } else if r != i { - dep := b.registry[regionISO.s[r-isoOffset]].deprecated - if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) { - fromM49map[m49] = i - } - } - } - for _, ta := range b.supp.Metadata.Alias.TerritoryAlias { - if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 { - from := parseM49(ta.Type) - if r := fromM49map[from]; r == 0 { - fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset - } - } - } - for _, tc := range b.supp.CodeMappings.TerritoryCodes { - if len(tc.Alpha3) == 3 { - update(tc.Type, tc.Alpha3) - } - } - // This entries are not included in territoryCodes. Mostly 3-letter variants - // of deleted codes and an entry for QU. - for _, m := range []struct{ iso2, iso3 string }{ - {"CT", "CTE"}, - {"DY", "DHY"}, - {"HV", "HVO"}, - {"JT", "JTN"}, - {"MI", "MID"}, - {"NH", "NHB"}, - {"NQ", "ATN"}, - {"PC", "PCI"}, - {"PU", "PUS"}, - {"PZ", "PCZ"}, - {"RH", "RHO"}, - {"VD", "VDR"}, - {"WK", "WAK"}, - // These three-letter codes are used for others as well. - {"FQ", "ATF"}, - } { - update(m.iso2, m.iso3) - } - for i, s := range regionISO.s { - if len(s) != 4 { - regionISO.s[i] = s + " " - } - } - b.writeConst("regionISO", tag.Index(regionISO.join())) - b.writeConst("altRegionISO3", altRegionISO3) - b.writeSlice("altRegionIDs", altRegionIDs) - - // Create list of deprecated regions. - // TODO: consider inserting SF -> FI. Not included by CLDR, but is the only - // Transitionally-reserved mapping not included. - regionOldMap := stringSet{} - // Include regions in territoryAlias (not all are in the IANA registry!) - for _, reg := range b.supp.Metadata.Alias.TerritoryAlias { - if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 { - regionOldMap.add(reg.Type) - regionOldMap.updateLater(reg.Type, reg.Replacement) - i, _ := regionISO.find(reg.Type) - j, _ := regionISO.find(reg.Replacement) - if k := m49map[i+isoOffset]; k == 0 { - m49map[i+isoOffset] = m49map[j+isoOffset] - } - } - } - b.writeSortedMap("regionOldMap", ®ionOldMap, func(s string) uint16 { - return uint16(b.region.index(s)) - }) - // 3-digit region lookup, groupings. - for i := 1; i < isoOffset; i++ { - m := parseM49(b.region.s[i]) - m49map[i] = m - fromM49map[m] = i - } - b.writeSlice("m49", m49map) - - const ( - searchBits = 7 - regionBits = 9 - ) - if len(m49map) >= 1<<regionBits { - log.Fatalf("Maximum number of regions exceeded: %d > %d", len(m49map), 1<<regionBits) - } - m49Index := [9]int16{} - fromM49 := []uint16{} - m49 := []int{} - for k, _ := range fromM49map { - m49 = append(m49, int(k)) - } - sort.Ints(m49) - for _, k := range m49[1:] { - val := (k & (1<<searchBits - 1)) << regionBits - fromM49 = append(fromM49, uint16(val|fromM49map[int16(k)])) - m49Index[1:][k>>searchBits] = int16(len(fromM49)) - } - b.writeSlice("m49Index", m49Index) - b.writeSlice("fromM49", fromM49) -} - -const ( - // TODO: put these lists in regionTypes as user data? Could be used for - // various optimizations and refinements and could be exposed in the API. - iso3166Except = "AC CP DG EA EU FX IC SU TA UK" - iso3166Trans = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions. - // DY and RH are actually not deleted, but indeterminately reserved. - iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD" -) - -const ( - iso3166UserAssigned = 1 << iota - ccTLD - bcp47Region -) - -func find(list []string, s string) int { - for i, t := range list { - if t == s { - return i - } - } - return -1 -} - -// writeVariants generates per-variant information and creates a map from variant -// name to index value. We assign index values such that sorting multiple -// variants by index value will result in the correct order. -// There are two types of variants: specialized and general. Specialized variants -// are only applicable to certain language or language-script pairs. Generalized -// variants apply to any language. Generalized variants always sort after -// specialized variants. We will therefore always assign a higher index value -// to a generalized variant than any other variant. Generalized variants are -// sorted alphabetically among themselves. -// Specialized variants may also sort after other specialized variants. Such -// variants will be ordered after any of the variants they may follow. -// We assume that if a variant x is followed by a variant y, then for any prefix -// p of x, p-x is a prefix of y. This allows us to order tags based on the -// maximum of the length of any of its prefixes. -// TODO: it is possible to define a set of Prefix values on variants such that -// a total order cannot be defined to the point that this algorithm breaks. -// In other words, we cannot guarantee the same order of variants for the -// future using the same algorithm or for non-compliant combinations of -// variants. For this reason, consider using simple alphabetic sorting -// of variants and ignore Prefix restrictions altogether. -func (b *builder) writeVariant() { - generalized := stringSet{} - specialized := stringSet{} - specializedExtend := stringSet{} - // Collate the variants by type and check assumptions. - for _, v := range b.variant.slice() { - e := b.registry[v] - if len(e.prefix) == 0 { - generalized.add(v) - continue - } - c := strings.Split(e.prefix[0], "-") - hasScriptOrRegion := false - if len(c) > 1 { - _, hasScriptOrRegion = b.script.find(c[1]) - if !hasScriptOrRegion { - _, hasScriptOrRegion = b.region.find(c[1]) - - } - } - if len(c) == 1 || len(c) == 2 && hasScriptOrRegion { - // Variant is preceded by a language. - specialized.add(v) - continue - } - // Variant is preceded by another variant. - specializedExtend.add(v) - prefix := c[0] + "-" - if hasScriptOrRegion { - prefix += c[1] - } - for _, p := range e.prefix { - // Verify that the prefix minus the last element is a prefix of the - // predecessor element. - i := strings.LastIndex(p, "-") - pred := b.registry[p[i+1:]] - if find(pred.prefix, p[:i]) < 0 { - log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v) - } - // The sorting used below does not work in the general case. It works - // if we assume that variants that may be followed by others only have - // prefixes of the same length. Verify this. - count := strings.Count(p[:i], "-") - for _, q := range pred.prefix { - if c := strings.Count(q, "-"); c != count { - log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count) - } - } - if !strings.HasPrefix(p, prefix) { - log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix) - } - } - } - - // Sort extended variants. - a := specializedExtend.s - less := func(v, w string) bool { - // Sort by the maximum number of elements. - maxCount := func(s string) (max int) { - for _, p := range b.registry[s].prefix { - if c := strings.Count(p, "-"); c > max { - max = c - } - } - return - } - if cv, cw := maxCount(v), maxCount(w); cv != cw { - return cv < cw - } - // Sort by name as tie breaker. - return v < w - } - sort.Sort(funcSorter{less, sort.StringSlice(a)}) - specializedExtend.frozen = true - - // Create index from variant name to index. - variantIndex := make(map[string]uint8) - add := func(s []string) { - for _, v := range s { - variantIndex[v] = uint8(len(variantIndex)) - } - } - add(specialized.slice()) - add(specializedExtend.s) - numSpecialized := len(variantIndex) - add(generalized.slice()) - if n := len(variantIndex); n > 255 { - log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n) - } - b.writeMap("variantIndex", variantIndex) - b.writeConst("variantNumSpecialized", numSpecialized) -} - -func (b *builder) writeLanguageInfo() { -} - -// writeLikelyData writes tables that are used both for finding parent relations and for -// language matching. Each entry contains additional bits to indicate the status of the -// data to know when it cannot be used for parent relations. -func (b *builder) writeLikelyData() { - const ( - isList = 1 << iota - scriptInFrom - regionInFrom - ) - type ( // generated types - likelyScriptRegion struct { - region uint16 - script uint8 - flags uint8 - } - likelyLangScript struct { - lang uint16 - script uint8 - flags uint8 - } - likelyLangRegion struct { - lang uint16 - region uint16 - } - // likelyTag is used for getting likely tags for group regions, where - // the likely region might be a region contained in the group. - likelyTag struct { - lang uint16 - region uint16 - script uint8 - } - ) - var ( // generated variables - likelyRegionGroup = make([]likelyTag, len(b.groups)) - likelyLang = make([]likelyScriptRegion, len(b.lang.s)) - likelyRegion = make([]likelyLangScript, len(b.region.s)) - likelyScript = make([]likelyLangRegion, len(b.script.s)) - likelyLangList = []likelyScriptRegion{} - likelyRegionList = []likelyLangScript{} - ) - type fromTo struct { - from, to []string - } - langToOther := map[int][]fromTo{} - regionToOther := map[int][]fromTo{} - for _, m := range b.supp.LikelySubtags.LikelySubtag { - from := strings.Split(m.From, "_") - to := strings.Split(m.To, "_") - if len(to) != 3 { - log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to)) - } - if len(from) > 3 { - log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from)) - } - if from[0] != to[0] && from[0] != "und" { - log.Fatalf("unexpected language change in expansion: %s -> %s", from, to) - } - if len(from) == 3 { - if from[2] != to[2] { - log.Fatalf("unexpected region change in expansion: %s -> %s", from, to) - } - if from[0] != "und" { - log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to) - } - } - if len(from) == 1 || from[0] != "und" { - id := 0 - if from[0] != "und" { - id = b.lang.index(from[0]) - } - langToOther[id] = append(langToOther[id], fromTo{from, to}) - } else if len(from) == 2 && len(from[1]) == 4 { - sid := b.script.index(from[1]) - likelyScript[sid].lang = uint16(b.langIndex(to[0])) - likelyScript[sid].region = uint16(b.region.index(to[2])) - } else { - r := b.region.index(from[len(from)-1]) - if id, ok := b.groups[r]; ok { - if from[0] != "und" { - log.Fatalf("region changed unexpectedly: %s -> %s", from, to) - } - likelyRegionGroup[id].lang = uint16(b.langIndex(to[0])) - likelyRegionGroup[id].script = uint8(b.script.index(to[1])) - likelyRegionGroup[id].region = uint16(b.region.index(to[2])) - } else { - regionToOther[r] = append(regionToOther[r], fromTo{from, to}) - } - } - } - b.writeType(likelyLangRegion{}) - b.writeSlice("likelyScript", likelyScript) - - for id := range b.lang.s { - list := langToOther[id] - if len(list) == 1 { - likelyLang[id].region = uint16(b.region.index(list[0].to[2])) - likelyLang[id].script = uint8(b.script.index(list[0].to[1])) - } else if len(list) > 1 { - likelyLang[id].flags = isList - likelyLang[id].region = uint16(len(likelyLangList)) - likelyLang[id].script = uint8(len(list)) - for _, x := range list { - flags := uint8(0) - if len(x.from) > 1 { - if x.from[1] == x.to[2] { - flags = regionInFrom - } else { - flags = scriptInFrom - } - } - likelyLangList = append(likelyLangList, likelyScriptRegion{ - region: uint16(b.region.index(x.to[2])), - script: uint8(b.script.index(x.to[1])), - flags: flags, - }) - } - } - } - // TODO: merge suppressScript data with this table. - b.writeType(likelyScriptRegion{}) - b.writeSlice("likelyLang", likelyLang) - b.writeSlice("likelyLangList", likelyLangList) - - for id := range b.region.s { - list := regionToOther[id] - if len(list) == 1 { - likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0])) - likelyRegion[id].script = uint8(b.script.index(list[0].to[1])) - if len(list[0].from) > 2 { - likelyRegion[id].flags = scriptInFrom - } - } else if len(list) > 1 { - likelyRegion[id].flags = isList - likelyRegion[id].lang = uint16(len(likelyRegionList)) - likelyRegion[id].script = uint8(len(list)) - for i, x := range list { - if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 { - log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i) - } - x := likelyLangScript{ - lang: uint16(b.langIndex(x.to[0])), - script: uint8(b.script.index(x.to[1])), - } - if len(list[0].from) > 2 { - x.flags = scriptInFrom - } - likelyRegionList = append(likelyRegionList, x) - } - } - } - b.writeType(likelyLangScript{}) - b.writeSlice("likelyRegion", likelyRegion) - b.writeSlice("likelyRegionList", likelyRegionList) - - b.writeType(likelyTag{}) - b.writeSlice("likelyRegionGroup", likelyRegionGroup) -} - -func (b *builder) writeRegionInclusionData() { - var ( - // mm holds for each group the set of groups with a distance of 1. - mm = make(map[int][]index) - - // containment holds for each group the transitive closure of - // containment of other groups. - containment = make(map[index][]index) - ) - for _, g := range b.supp.TerritoryContainment.Group { - // Skip UN and EURO zone as they are flattening the containment - // relationship. - if g.Type == "EZ" || g.Type == "UN" { - continue - } - group := b.region.index(g.Type) - groupIdx := b.groups[group] - for _, mem := range strings.Split(g.Contains, " ") { - r := b.region.index(mem) - mm[r] = append(mm[r], groupIdx) - if g, ok := b.groups[r]; ok { - mm[group] = append(mm[group], g) - containment[groupIdx] = append(containment[groupIdx], g) - } - } - } - - regionContainment := make([]uint64, len(b.groups)) - for _, g := range b.groups { - l := containment[g] - - // Compute the transitive closure of containment. - for i := 0; i < len(l); i++ { - l = append(l, containment[l[i]]...) - } - - // Compute the bitmask. - regionContainment[g] = 1 << g - for _, v := range l { - regionContainment[g] |= 1 << v - } - } - b.writeSlice("regionContainment", regionContainment) - - regionInclusion := make([]uint8, len(b.region.s)) - bvs := make(map[uint64]index) - // Make the first bitvector positions correspond with the groups. - for r, i := range b.groups { - bv := uint64(1 << i) - for _, g := range mm[r] { - bv |= 1 << g - } - bvs[bv] = i - regionInclusion[r] = uint8(bvs[bv]) - } - for r := 1; r < len(b.region.s); r++ { - if _, ok := b.groups[r]; !ok { - bv := uint64(0) - for _, g := range mm[r] { - bv |= 1 << g - } - if bv == 0 { - // Pick the world for unspecified regions. - bv = 1 << b.groups[b.region.index("001")] - } - if _, ok := bvs[bv]; !ok { - bvs[bv] = index(len(bvs)) - } - regionInclusion[r] = uint8(bvs[bv]) - } - } - b.writeSlice("regionInclusion", regionInclusion) - regionInclusionBits := make([]uint64, len(bvs)) - for k, v := range bvs { - regionInclusionBits[v] = uint64(k) - } - // Add bit vectors for increasingly large distances until a fixed point is reached. - regionInclusionNext := []uint8{} - for i := 0; i < len(regionInclusionBits); i++ { - bits := regionInclusionBits[i] - next := bits - for i := uint(0); i < uint(len(b.groups)); i++ { - if bits&(1<<i) != 0 { - next |= regionInclusionBits[i] - } - } - if _, ok := bvs[next]; !ok { - bvs[next] = index(len(bvs)) - regionInclusionBits = append(regionInclusionBits, next) - } - regionInclusionNext = append(regionInclusionNext, uint8(bvs[next])) - } - b.writeSlice("regionInclusionBits", regionInclusionBits) - b.writeSlice("regionInclusionNext", regionInclusionNext) -} - -type parentRel struct { - lang uint16 - script uint8 - maxScript uint8 - toRegion uint16 - fromRegion []uint16 -} - -func (b *builder) writeParents() { - b.writeType(parentRel{}) - - parents := []parentRel{} - - // Construct parent overrides. - n := 0 - for _, p := range b.data.Supplemental().ParentLocales.ParentLocale { - // Skipping non-standard scripts to root is implemented using addTags. - if p.Parent == "root" { - continue - } - - sub := strings.Split(p.Parent, "_") - parent := parentRel{lang: b.langIndex(sub[0])} - if len(sub) == 2 { - // TODO: check that all undefined scripts are indeed Latn in these - // cases. - parent.maxScript = uint8(b.script.index("Latn")) - parent.toRegion = uint16(b.region.index(sub[1])) - } else { - parent.script = uint8(b.script.index(sub[1])) - parent.maxScript = parent.script - parent.toRegion = uint16(b.region.index(sub[2])) - } - for _, c := range strings.Split(p.Locales, " ") { - region := b.region.index(c[strings.LastIndex(c, "_")+1:]) - parent.fromRegion = append(parent.fromRegion, uint16(region)) - } - parents = append(parents, parent) - n += len(parent.fromRegion) - } - b.writeSliceAddSize("parents", n*2, parents) -} - -func main() { - gen.Init() - - gen.Repackage("gen_common.go", "common.go", "language") - - w := gen.NewCodeWriter() - defer w.WriteGoFile("tables.go", "language") - - fmt.Fprintln(w, `import "golang.org/x/text/internal/tag"`) - - b := newBuilder(w) - gen.WriteCLDRVersion(w) - - b.parseIndices() - b.writeType(FromTo{}) - b.writeLanguage() - b.writeScript() - b.writeRegion() - b.writeVariant() - // TODO: b.writeLocale() - b.computeRegionGroups() - b.writeLikelyData() - b.writeRegionInclusionData() - b.writeParents() -} diff --git a/vendor/golang.org/x/text/internal/language/gen_common.go b/vendor/golang.org/x/text/internal/language/gen_common.go deleted file mode 100644 index c419ceeb..00000000 --- a/vendor/golang.org/x/text/internal/language/gen_common.go +++ /dev/null @@ -1,20 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -package main - -// This file contains code common to the maketables.go and the package code. - -// AliasType is the type of an alias in AliasMap. -type AliasType int8 - -const ( - Deprecated AliasType = iota - Macro - Legacy - - AliasTypeUnknown AliasType = -1 -) diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go deleted file mode 100644 index aa5f5f42..00000000 --- a/vendor/golang.org/x/text/internal/language/language.go +++ /dev/null @@ -1,596 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate go run gen.go gen_common.go -output tables.go - -package language // import "golang.org/x/text/internal/language" - -// TODO: Remove above NOTE after: -// - verifying that tables are dropped correctly (most notably matcher tables). - -import ( - "errors" - "fmt" - "strings" -) - -const ( - // maxCoreSize is the maximum size of a BCP 47 tag without variants and - // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. - maxCoreSize = 12 - - // max99thPercentileSize is a somewhat arbitrary buffer size that presumably - // is large enough to hold at least 99% of the BCP 47 tags. - max99thPercentileSize = 32 - - // maxSimpleUExtensionSize is the maximum size of a -u extension with one - // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). - maxSimpleUExtensionSize = 14 -) - -// Tag represents a BCP 47 language tag. It is used to specify an instance of a -// specific language or locale. All language tag values are guaranteed to be -// well-formed. The zero value of Tag is Und. -type Tag struct { - // TODO: the following fields have the form TagTypeID. This name is chosen - // to allow refactoring the public package without conflicting with its - // Base, Script, and Region methods. Once the transition is fully completed - // the ID can be stripped from the name. - - LangID Language - RegionID Region - // TODO: we will soon run out of positions for ScriptID. Idea: instead of - // storing lang, region, and ScriptID codes, store only the compact index and - // have a lookup table from this code to its expansion. This greatly speeds - // up table lookup, speed up common variant cases. - // This will also immediately free up 3 extra bytes. Also, the pVariant - // field can now be moved to the lookup table, as the compact index uniquely - // determines the offset of a possible variant. - ScriptID Script - pVariant byte // offset in str, includes preceding '-' - pExt uint16 // offset of first extension, includes preceding '-' - - // str is the string representation of the Tag. It will only be used if the - // tag has variants or extensions. - str string -} - -// Make is a convenience wrapper for Parse that omits the error. -// In case of an error, a sensible default is returned. -func Make(s string) Tag { - t, _ := Parse(s) - return t -} - -// Raw returns the raw base language, script and region, without making an -// attempt to infer their values. -// TODO: consider removing -func (t Tag) Raw() (b Language, s Script, r Region) { - return t.LangID, t.ScriptID, t.RegionID -} - -// equalTags compares language, script and region subtags only. -func (t Tag) equalTags(a Tag) bool { - return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID -} - -// IsRoot returns true if t is equal to language "und". -func (t Tag) IsRoot() bool { - if int(t.pVariant) < len(t.str) { - return false - } - return t.equalTags(Und) -} - -// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use -// tag. -func (t Tag) IsPrivateUse() bool { - return t.str != "" && t.pVariant == 0 -} - -// RemakeString is used to update t.str in case lang, script or region changed. -// It is assumed that pExt and pVariant still point to the start of the -// respective parts. -func (t *Tag) RemakeString() { - if t.str == "" { - return - } - extra := t.str[t.pVariant:] - if t.pVariant > 0 { - extra = extra[1:] - } - if t.equalTags(Und) && strings.HasPrefix(extra, "x-") { - t.str = extra - t.pVariant = 0 - t.pExt = 0 - return - } - var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. - b := buf[:t.genCoreBytes(buf[:])] - if extra != "" { - diff := len(b) - int(t.pVariant) - b = append(b, '-') - b = append(b, extra...) - t.pVariant = uint8(int(t.pVariant) + diff) - t.pExt = uint16(int(t.pExt) + diff) - } else { - t.pVariant = uint8(len(b)) - t.pExt = uint16(len(b)) - } - t.str = string(b) -} - -// genCoreBytes writes a string for the base languages, script and region tags -// to the given buffer and returns the number of bytes written. It will never -// write more than maxCoreSize bytes. -func (t *Tag) genCoreBytes(buf []byte) int { - n := t.LangID.StringToBuf(buf[:]) - if t.ScriptID != 0 { - n += copy(buf[n:], "-") - n += copy(buf[n:], t.ScriptID.String()) - } - if t.RegionID != 0 { - n += copy(buf[n:], "-") - n += copy(buf[n:], t.RegionID.String()) - } - return n -} - -// String returns the canonical string representation of the language tag. -func (t Tag) String() string { - if t.str != "" { - return t.str - } - if t.ScriptID == 0 && t.RegionID == 0 { - return t.LangID.String() - } - buf := [maxCoreSize]byte{} - return string(buf[:t.genCoreBytes(buf[:])]) -} - -// MarshalText implements encoding.TextMarshaler. -func (t Tag) MarshalText() (text []byte, err error) { - if t.str != "" { - text = append(text, t.str...) - } else if t.ScriptID == 0 && t.RegionID == 0 { - text = append(text, t.LangID.String()...) - } else { - buf := [maxCoreSize]byte{} - text = buf[:t.genCoreBytes(buf[:])] - } - return text, nil -} - -// UnmarshalText implements encoding.TextUnmarshaler. -func (t *Tag) UnmarshalText(text []byte) error { - tag, err := Parse(string(text)) - *t = tag - return err -} - -// Variants returns the part of the tag holding all variants or the empty string -// if there are no variants defined. -func (t Tag) Variants() string { - if t.pVariant == 0 { - return "" - } - return t.str[t.pVariant:t.pExt] -} - -// VariantOrPrivateUseTags returns variants or private use tags. -func (t Tag) VariantOrPrivateUseTags() string { - if t.pExt > 0 { - return t.str[t.pVariant:t.pExt] - } - return t.str[t.pVariant:] -} - -// HasString reports whether this tag defines more than just the raw -// components. -func (t Tag) HasString() bool { - return t.str != "" -} - -// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a -// specific language are substituted with fields from the parent language. -// The parent for a language may change for newer versions of CLDR. -func (t Tag) Parent() Tag { - if t.str != "" { - // Strip the variants and extensions. - b, s, r := t.Raw() - t = Tag{LangID: b, ScriptID: s, RegionID: r} - if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 { - base, _ := addTags(Tag{LangID: t.LangID}) - if base.ScriptID == t.ScriptID { - return Tag{LangID: t.LangID} - } - } - return t - } - if t.LangID != 0 { - if t.RegionID != 0 { - maxScript := t.ScriptID - if maxScript == 0 { - max, _ := addTags(t) - maxScript = max.ScriptID - } - - for i := range parents { - if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript { - for _, r := range parents[i].fromRegion { - if Region(r) == t.RegionID { - return Tag{ - LangID: t.LangID, - ScriptID: Script(parents[i].script), - RegionID: Region(parents[i].toRegion), - } - } - } - } - } - - // Strip the script if it is the default one. - base, _ := addTags(Tag{LangID: t.LangID}) - if base.ScriptID != maxScript { - return Tag{LangID: t.LangID, ScriptID: maxScript} - } - return Tag{LangID: t.LangID} - } else if t.ScriptID != 0 { - // The parent for an base-script pair with a non-default script is - // "und" instead of the base language. - base, _ := addTags(Tag{LangID: t.LangID}) - if base.ScriptID != t.ScriptID { - return Und - } - return Tag{LangID: t.LangID} - } - } - return Und -} - -// ParseExtension parses s as an extension and returns it on success. -func ParseExtension(s string) (ext string, err error) { - scan := makeScannerString(s) - var end int - if n := len(scan.token); n != 1 { - return "", ErrSyntax - } - scan.toLower(0, len(scan.b)) - end = parseExtension(&scan) - if end != len(s) { - return "", ErrSyntax - } - return string(scan.b), nil -} - -// HasVariants reports whether t has variants. -func (t Tag) HasVariants() bool { - return uint16(t.pVariant) < t.pExt -} - -// HasExtensions reports whether t has extensions. -func (t Tag) HasExtensions() bool { - return int(t.pExt) < len(t.str) -} - -// Extension returns the extension of type x for tag t. It will return -// false for ok if t does not have the requested extension. The returned -// extension will be invalid in this case. -func (t Tag) Extension(x byte) (ext string, ok bool) { - for i := int(t.pExt); i < len(t.str)-1; { - var ext string - i, ext = getExtension(t.str, i) - if ext[0] == x { - return ext, true - } - } - return "", false -} - -// Extensions returns all extensions of t. -func (t Tag) Extensions() []string { - e := []string{} - for i := int(t.pExt); i < len(t.str)-1; { - var ext string - i, ext = getExtension(t.str, i) - e = append(e, ext) - } - return e -} - -// TypeForKey returns the type associated with the given key, where key and type -// are of the allowed values defined for the Unicode locale extension ('u') in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// TypeForKey will traverse the inheritance chain to get the correct value. -func (t Tag) TypeForKey(key string) string { - if start, end, _ := t.findTypeForKey(key); end != start { - return t.str[start:end] - } - return "" -} - -var ( - errPrivateUse = errors.New("cannot set a key on a private use tag") - errInvalidArguments = errors.New("invalid key or type") -) - -// SetTypeForKey returns a new Tag with the key set to type, where key and type -// are of the allowed values defined for the Unicode locale extension ('u') in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// An empty value removes an existing pair with the same key. -func (t Tag) SetTypeForKey(key, value string) (Tag, error) { - if t.IsPrivateUse() { - return t, errPrivateUse - } - if len(key) != 2 { - return t, errInvalidArguments - } - - // Remove the setting if value is "". - if value == "" { - start, end, _ := t.findTypeForKey(key) - if start != end { - // Remove key tag and leading '-'. - start -= 4 - - // Remove a possible empty extension. - if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' { - start -= 2 - } - if start == int(t.pVariant) && end == len(t.str) { - t.str = "" - t.pVariant, t.pExt = 0, 0 - } else { - t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) - } - } - return t, nil - } - - if len(value) < 3 || len(value) > 8 { - return t, errInvalidArguments - } - - var ( - buf [maxCoreSize + maxSimpleUExtensionSize]byte - uStart int // start of the -u extension. - ) - - // Generate the tag string if needed. - if t.str == "" { - uStart = t.genCoreBytes(buf[:]) - buf[uStart] = '-' - uStart++ - } - - // Create new key-type pair and parse it to verify. - b := buf[uStart:] - copy(b, "u-") - copy(b[2:], key) - b[4] = '-' - b = b[:5+copy(b[5:], value)] - scan := makeScanner(b) - if parseExtensions(&scan); scan.err != nil { - return t, scan.err - } - - // Assemble the replacement string. - if t.str == "" { - t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) - t.str = string(buf[:uStart+len(b)]) - } else { - s := t.str - start, end, hasExt := t.findTypeForKey(key) - if start == end { - if hasExt { - b = b[2:] - } - t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:]) - } else { - t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:]) - } - } - return t, nil -} - -// findKeyAndType returns the start and end position for the type corresponding -// to key or the point at which to insert the key-value pair if the type -// wasn't found. The hasExt return value reports whether an -u extension was present. -// Note: the extensions are typically very small and are likely to contain -// only one key-type pair. -func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) { - p := int(t.pExt) - if len(key) != 2 || p == len(t.str) || p == 0 { - return p, p, false - } - s := t.str - - // Find the correct extension. - for p++; s[p] != 'u'; p++ { - if s[p] > 'u' { - p-- - return p, p, false - } - if p = nextExtension(s, p); p == len(s) { - return len(s), len(s), false - } - } - // Proceed to the hyphen following the extension name. - p++ - - // curKey is the key currently being processed. - curKey := "" - - // Iterate over keys until we get the end of a section. - for { - // p points to the hyphen preceding the current token. - if p3 := p + 3; s[p3] == '-' { - // Found a key. - // Check whether we just processed the key that was requested. - if curKey == key { - return start, p, true - } - // Set to the next key and continue scanning type tokens. - curKey = s[p+1 : p3] - if curKey > key { - return p, p, true - } - // Start of the type token sequence. - start = p + 4 - // A type is at least 3 characters long. - p += 7 // 4 + 3 - } else { - // Attribute or type, which is at least 3 characters long. - p += 4 - } - // p points past the third character of a type or attribute. - max := p + 5 // maximum length of token plus hyphen. - if len(s) < max { - max = len(s) - } - for ; p < max && s[p] != '-'; p++ { - } - // Bail if we have exhausted all tokens or if the next token starts - // a new extension. - if p == len(s) || s[p+2] == '-' { - if curKey == key { - return start, p, true - } - return p, p, true - } - } -} - -// ParseBase parses a 2- or 3-letter ISO 639 code. -// It returns a ValueError if s is a well-formed but unknown language identifier -// or another error if another error occurred. -func ParseBase(s string) (Language, error) { - if n := len(s); n < 2 || 3 < n { - return 0, ErrSyntax - } - var buf [3]byte - return getLangID(buf[:copy(buf[:], s)]) -} - -// ParseScript parses a 4-letter ISO 15924 code. -// It returns a ValueError if s is a well-formed but unknown script identifier -// or another error if another error occurred. -func ParseScript(s string) (Script, error) { - if len(s) != 4 { - return 0, ErrSyntax - } - var buf [4]byte - return getScriptID(script, buf[:copy(buf[:], s)]) -} - -// EncodeM49 returns the Region for the given UN M.49 code. -// It returns an error if r is not a valid code. -func EncodeM49(r int) (Region, error) { - return getRegionM49(r) -} - -// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. -// It returns a ValueError if s is a well-formed but unknown region identifier -// or another error if another error occurred. -func ParseRegion(s string) (Region, error) { - if n := len(s); n < 2 || 3 < n { - return 0, ErrSyntax - } - var buf [3]byte - return getRegionID(buf[:copy(buf[:], s)]) -} - -// IsCountry returns whether this region is a country or autonomous area. This -// includes non-standard definitions from CLDR. -func (r Region) IsCountry() bool { - if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK { - return false - } - return true -} - -// IsGroup returns whether this region defines a collection of regions. This -// includes non-standard definitions from CLDR. -func (r Region) IsGroup() bool { - if r == 0 { - return false - } - return int(regionInclusion[r]) < len(regionContainment) -} - -// Contains returns whether Region c is contained by Region r. It returns true -// if c == r. -func (r Region) Contains(c Region) bool { - if r == c { - return true - } - g := regionInclusion[r] - if g >= nRegionGroups { - return false - } - m := regionContainment[g] - - d := regionInclusion[c] - b := regionInclusionBits[d] - - // A contained country may belong to multiple disjoint groups. Matching any - // of these indicates containment. If the contained region is a group, it - // must strictly be a subset. - if d >= nRegionGroups { - return b&m != 0 - } - return b&^m == 0 -} - -var errNoTLD = errors.New("language: region is not a valid ccTLD") - -// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. -// In all other cases it returns either the region itself or an error. -// -// This method may return an error for a region for which there exists a -// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The -// region will already be canonicalized it was obtained from a Tag that was -// obtained using any of the default methods. -func (r Region) TLD() (Region, error) { - // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the - // difference between ISO 3166-1 and IANA ccTLD. - if r == _GB { - r = _UK - } - if (r.typ() & ccTLD) == 0 { - return 0, errNoTLD - } - return r, nil -} - -// Canonicalize returns the region or a possible replacement if the region is -// deprecated. It will not return a replacement for deprecated regions that -// are split into multiple regions. -func (r Region) Canonicalize() Region { - if cr := normRegion(r); cr != 0 { - return cr - } - return r -} - -// Variant represents a registered variant of a language as defined by BCP 47. -type Variant struct { - ID uint8 - str string -} - -// ParseVariant parses and returns a Variant. An error is returned if s is not -// a valid variant. -func ParseVariant(s string) (Variant, error) { - s = strings.ToLower(s) - if id, ok := variantIndex[s]; ok { - return Variant{id, s}, nil - } - return Variant{}, NewValueError([]byte(s)) -} - -// String returns the string representation of the variant. -func (v Variant) String() string { - return v.str -} diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go deleted file mode 100644 index 6294b815..00000000 --- a/vendor/golang.org/x/text/internal/language/lookup.go +++ /dev/null @@ -1,412 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "bytes" - "fmt" - "sort" - "strconv" - - "golang.org/x/text/internal/tag" -) - -// findIndex tries to find the given tag in idx and returns a standardized error -// if it could not be found. -func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { - if !tag.FixCase(form, key) { - return 0, ErrSyntax - } - i := idx.Index(key) - if i == -1 { - return 0, NewValueError(key) - } - return i, nil -} - -func searchUint(imap []uint16, key uint16) int { - return sort.Search(len(imap), func(i int) bool { - return imap[i] >= key - }) -} - -type Language uint16 - -// getLangID returns the langID of s if s is a canonical subtag -// or langUnknown if s is not a canonical subtag. -func getLangID(s []byte) (Language, error) { - if len(s) == 2 { - return getLangISO2(s) - } - return getLangISO3(s) -} - -// TODO language normalization as well as the AliasMaps could be moved to the -// higher level package, but it is a bit tricky to separate the generation. - -func (id Language) Canonicalize() (Language, AliasType) { - return normLang(id) -} - -// mapLang returns the mapped langID of id according to mapping m. -func normLang(id Language) (Language, AliasType) { - k := sort.Search(len(AliasMap), func(i int) bool { - return AliasMap[i].From >= uint16(id) - }) - if k < len(AliasMap) && AliasMap[k].From == uint16(id) { - return Language(AliasMap[k].To), AliasTypes[k] - } - return id, AliasTypeUnknown -} - -// getLangISO2 returns the langID for the given 2-letter ISO language code -// or unknownLang if this does not exist. -func getLangISO2(s []byte) (Language, error) { - if !tag.FixCase("zz", s) { - return 0, ErrSyntax - } - if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { - return Language(i), nil - } - return 0, NewValueError(s) -} - -const base = 'z' - 'a' + 1 - -func strToInt(s []byte) uint { - v := uint(0) - for i := 0; i < len(s); i++ { - v *= base - v += uint(s[i] - 'a') - } - return v -} - -// converts the given integer to the original ASCII string passed to strToInt. -// len(s) must match the number of characters obtained. -func intToStr(v uint, s []byte) { - for i := len(s) - 1; i >= 0; i-- { - s[i] = byte(v%base) + 'a' - v /= base - } -} - -// getLangISO3 returns the langID for the given 3-letter ISO language code -// or unknownLang if this does not exist. -func getLangISO3(s []byte) (Language, error) { - if tag.FixCase("und", s) { - // first try to match canonical 3-letter entries - for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { - if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] { - // We treat "und" as special and always translate it to "unspecified". - // Note that ZZ and Zzzz are private use and are not treated as - // unspecified by default. - id := Language(i) - if id == nonCanonicalUnd { - return 0, nil - } - return id, nil - } - } - if i := altLangISO3.Index(s); i != -1 { - return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil - } - n := strToInt(s) - if langNoIndex[n/8]&(1<<(n%8)) != 0 { - return Language(n) + langNoIndexOffset, nil - } - // Check for non-canonical uses of ISO3. - for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { - if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { - return Language(i), nil - } - } - return 0, NewValueError(s) - } - return 0, ErrSyntax -} - -// StringToBuf writes the string to b and returns the number of bytes -// written. cap(b) must be >= 3. -func (id Language) StringToBuf(b []byte) int { - if id >= langNoIndexOffset { - intToStr(uint(id)-langNoIndexOffset, b[:3]) - return 3 - } else if id == 0 { - return copy(b, "und") - } - l := lang[id<<2:] - if l[3] == 0 { - return copy(b, l[:3]) - } - return copy(b, l[:2]) -} - -// String returns the BCP 47 representation of the langID. -// Use b as variable name, instead of id, to ensure the variable -// used is consistent with that of Base in which this type is embedded. -func (b Language) String() string { - if b == 0 { - return "und" - } else if b >= langNoIndexOffset { - b -= langNoIndexOffset - buf := [3]byte{} - intToStr(uint(b), buf[:]) - return string(buf[:]) - } - l := lang.Elem(int(b)) - if l[3] == 0 { - return l[:3] - } - return l[:2] -} - -// ISO3 returns the ISO 639-3 language code. -func (b Language) ISO3() string { - if b == 0 || b >= langNoIndexOffset { - return b.String() - } - l := lang.Elem(int(b)) - if l[3] == 0 { - return l[:3] - } else if l[2] == 0 { - return altLangISO3.Elem(int(l[3]))[:3] - } - // This allocation will only happen for 3-letter ISO codes - // that are non-canonical BCP 47 language identifiers. - return l[0:1] + l[2:4] -} - -// IsPrivateUse reports whether this language code is reserved for private use. -func (b Language) IsPrivateUse() bool { - return langPrivateStart <= b && b <= langPrivateEnd -} - -// SuppressScript returns the script marked as SuppressScript in the IANA -// language tag repository, or 0 if there is no such script. -func (b Language) SuppressScript() Script { - if b < langNoIndexOffset { - return Script(suppressScript[b]) - } - return 0 -} - -type Region uint16 - -// getRegionID returns the region id for s if s is a valid 2-letter region code -// or unknownRegion. -func getRegionID(s []byte) (Region, error) { - if len(s) == 3 { - if isAlpha(s[0]) { - return getRegionISO3(s) - } - if i, err := strconv.ParseUint(string(s), 10, 10); err == nil { - return getRegionM49(int(i)) - } - } - return getRegionISO2(s) -} - -// getRegionISO2 returns the regionID for the given 2-letter ISO country code -// or unknownRegion if this does not exist. -func getRegionISO2(s []byte) (Region, error) { - i, err := findIndex(regionISO, s, "ZZ") - if err != nil { - return 0, err - } - return Region(i) + isoRegionOffset, nil -} - -// getRegionISO3 returns the regionID for the given 3-letter ISO country code -// or unknownRegion if this does not exist. -func getRegionISO3(s []byte) (Region, error) { - if tag.FixCase("ZZZ", s) { - for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { - if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { - return Region(i) + isoRegionOffset, nil - } - } - for i := 0; i < len(altRegionISO3); i += 3 { - if tag.Compare(altRegionISO3[i:i+3], s) == 0 { - return Region(altRegionIDs[i/3]), nil - } - } - return 0, NewValueError(s) - } - return 0, ErrSyntax -} - -func getRegionM49(n int) (Region, error) { - if 0 < n && n <= 999 { - const ( - searchBits = 7 - regionBits = 9 - regionMask = 1<<regionBits - 1 - ) - idx := n >> searchBits - buf := fromM49[m49Index[idx]:m49Index[idx+1]] - val := uint16(n) << regionBits // we rely on bits shifting out - i := sort.Search(len(buf), func(i int) bool { - return buf[i] >= val - }) - if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { - return Region(r & regionMask), nil - } - } - var e ValueError - fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n) - return 0, e -} - -// normRegion returns a region if r is deprecated or 0 otherwise. -// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). -// TODO: consider mapping split up regions to new most populous one (like CLDR). -func normRegion(r Region) Region { - m := regionOldMap - k := sort.Search(len(m), func(i int) bool { - return m[i].From >= uint16(r) - }) - if k < len(m) && m[k].From == uint16(r) { - return Region(m[k].To) - } - return 0 -} - -const ( - iso3166UserAssigned = 1 << iota - ccTLD - bcp47Region -) - -func (r Region) typ() byte { - return regionTypes[r] -} - -// String returns the BCP 47 representation for the region. -// It returns "ZZ" for an unspecified region. -func (r Region) String() string { - if r < isoRegionOffset { - if r == 0 { - return "ZZ" - } - return fmt.Sprintf("%03d", r.M49()) - } - r -= isoRegionOffset - return regionISO.Elem(int(r))[:2] -} - -// ISO3 returns the 3-letter ISO code of r. -// Note that not all regions have a 3-letter ISO code. -// In such cases this method returns "ZZZ". -func (r Region) ISO3() string { - if r < isoRegionOffset { - return "ZZZ" - } - r -= isoRegionOffset - reg := regionISO.Elem(int(r)) - switch reg[2] { - case 0: - return altRegionISO3[reg[3]:][:3] - case ' ': - return "ZZZ" - } - return reg[0:1] + reg[2:4] -} - -// M49 returns the UN M.49 encoding of r, or 0 if this encoding -// is not defined for r. -func (r Region) M49() int { - return int(m49[r]) -} - -// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This -// may include private-use tags that are assigned by CLDR and used in this -// implementation. So IsPrivateUse and IsCountry can be simultaneously true. -func (r Region) IsPrivateUse() bool { - return r.typ()&iso3166UserAssigned != 0 -} - -type Script uint8 - -// getScriptID returns the script id for string s. It assumes that s -// is of the format [A-Z][a-z]{3}. -func getScriptID(idx tag.Index, s []byte) (Script, error) { - i, err := findIndex(idx, s, "Zzzz") - return Script(i), err -} - -// String returns the script code in title case. -// It returns "Zzzz" for an unspecified script. -func (s Script) String() string { - if s == 0 { - return "Zzzz" - } - return script.Elem(int(s)) -} - -// IsPrivateUse reports whether this script code is reserved for private use. -func (s Script) IsPrivateUse() bool { - return _Qaaa <= s && s <= _Qabx -} - -const ( - maxAltTaglen = len("en-US-POSIX") - maxLen = maxAltTaglen -) - -var ( - // grandfatheredMap holds a mapping from legacy and grandfathered tags to - // their base language or index to more elaborate tag. - grandfatheredMap = map[[maxLen]byte]int16{ - [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban - [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami - [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn - [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak - [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon - [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux - [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo - [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn - [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao - [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay - [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu - [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok - [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn - [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR - [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL - [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE - [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu - [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka - [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan - [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang - - // Grandfathered tags with no modern replacement will be converted as - // follows: - [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish - [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed - [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default - [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian - [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo - [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min - - // CLDR-specific tag. - [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root - [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX" - } - - altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102} - - altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix" -) - -func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { - if v, ok := grandfatheredMap[s]; ok { - if v < 0 { - return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true - } - t.LangID = Language(v) - return t, true - } - return t, false -} diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go deleted file mode 100644 index 75a2dbca..00000000 --- a/vendor/golang.org/x/text/internal/language/match.go +++ /dev/null @@ -1,226 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import "errors" - -type scriptRegionFlags uint8 - -const ( - isList = 1 << iota - scriptInFrom - regionInFrom -) - -func (t *Tag) setUndefinedLang(id Language) { - if t.LangID == 0 { - t.LangID = id - } -} - -func (t *Tag) setUndefinedScript(id Script) { - if t.ScriptID == 0 { - t.ScriptID = id - } -} - -func (t *Tag) setUndefinedRegion(id Region) { - if t.RegionID == 0 || t.RegionID.Contains(id) { - t.RegionID = id - } -} - -// ErrMissingLikelyTagsData indicates no information was available -// to compute likely values of missing tags. -var ErrMissingLikelyTagsData = errors.New("missing likely tags data") - -// addLikelySubtags sets subtags to their most likely value, given the locale. -// In most cases this means setting fields for unknown values, but in some -// cases it may alter a value. It returns an ErrMissingLikelyTagsData error -// if the given locale cannot be expanded. -func (t Tag) addLikelySubtags() (Tag, error) { - id, err := addTags(t) - if err != nil { - return t, err - } else if id.equalTags(t) { - return t, nil - } - id.RemakeString() - return id, nil -} - -// specializeRegion attempts to specialize a group region. -func specializeRegion(t *Tag) bool { - if i := regionInclusion[t.RegionID]; i < nRegionGroups { - x := likelyRegionGroup[i] - if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID { - t.RegionID = Region(x.region) - } - return true - } - return false -} - -// Maximize returns a new tag with missing tags filled in. -func (t Tag) Maximize() (Tag, error) { - return addTags(t) -} - -func addTags(t Tag) (Tag, error) { - // We leave private use identifiers alone. - if t.IsPrivateUse() { - return t, nil - } - if t.ScriptID != 0 && t.RegionID != 0 { - if t.LangID != 0 { - // already fully specified - specializeRegion(&t) - return t, nil - } - // Search matches for und-script-region. Note that for these cases - // region will never be a group so there is no need to check for this. - list := likelyRegion[t.RegionID : t.RegionID+1] - if x := list[0]; x.flags&isList != 0 { - list = likelyRegionList[x.lang : x.lang+uint16(x.script)] - } - for _, x := range list { - // Deviating from the spec. See match_test.go for details. - if Script(x.script) == t.ScriptID { - t.setUndefinedLang(Language(x.lang)) - return t, nil - } - } - } - if t.LangID != 0 { - // Search matches for lang-script and lang-region, where lang != und. - if t.LangID < langNoIndexOffset { - x := likelyLang[t.LangID] - if x.flags&isList != 0 { - list := likelyLangList[x.region : x.region+uint16(x.script)] - if t.ScriptID != 0 { - for _, x := range list { - if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 { - t.setUndefinedRegion(Region(x.region)) - return t, nil - } - } - } else if t.RegionID != 0 { - count := 0 - goodScript := true - tt := t - for _, x := range list { - // We visit all entries for which the script was not - // defined, including the ones where the region was not - // defined. This allows for proper disambiguation within - // regions. - if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) { - tt.RegionID = Region(x.region) - tt.setUndefinedScript(Script(x.script)) - goodScript = goodScript && tt.ScriptID == Script(x.script) - count++ - } - } - if count == 1 { - return tt, nil - } - // Even if we fail to find a unique Region, we might have - // an unambiguous script. - if goodScript { - t.ScriptID = tt.ScriptID - } - } - } - } - } else { - // Search matches for und-script. - if t.ScriptID != 0 { - x := likelyScript[t.ScriptID] - if x.region != 0 { - t.setUndefinedRegion(Region(x.region)) - t.setUndefinedLang(Language(x.lang)) - return t, nil - } - } - // Search matches for und-region. If und-script-region exists, it would - // have been found earlier. - if t.RegionID != 0 { - if i := regionInclusion[t.RegionID]; i < nRegionGroups { - x := likelyRegionGroup[i] - if x.region != 0 { - t.setUndefinedLang(Language(x.lang)) - t.setUndefinedScript(Script(x.script)) - t.RegionID = Region(x.region) - } - } else { - x := likelyRegion[t.RegionID] - if x.flags&isList != 0 { - x = likelyRegionList[x.lang] - } - if x.script != 0 && x.flags != scriptInFrom { - t.setUndefinedLang(Language(x.lang)) - t.setUndefinedScript(Script(x.script)) - return t, nil - } - } - } - } - - // Search matches for lang. - if t.LangID < langNoIndexOffset { - x := likelyLang[t.LangID] - if x.flags&isList != 0 { - x = likelyLangList[x.region] - } - if x.region != 0 { - t.setUndefinedScript(Script(x.script)) - t.setUndefinedRegion(Region(x.region)) - } - specializeRegion(&t) - if t.LangID == 0 { - t.LangID = _en // default language - } - return t, nil - } - return t, ErrMissingLikelyTagsData -} - -func (t *Tag) setTagsFrom(id Tag) { - t.LangID = id.LangID - t.ScriptID = id.ScriptID - t.RegionID = id.RegionID -} - -// minimize removes the region or script subtags from t such that -// t.addLikelySubtags() == t.minimize().addLikelySubtags(). -func (t Tag) minimize() (Tag, error) { - t, err := minimizeTags(t) - if err != nil { - return t, err - } - t.RemakeString() - return t, nil -} - -// minimizeTags mimics the behavior of the ICU 51 C implementation. -func minimizeTags(t Tag) (Tag, error) { - if t.equalTags(Und) { - return t, nil - } - max, err := addTags(t) - if err != nil { - return t, err - } - for _, id := range [...]Tag{ - {LangID: t.LangID}, - {LangID: t.LangID, RegionID: t.RegionID}, - {LangID: t.LangID, ScriptID: t.ScriptID}, - } { - if x, err := addTags(id); err == nil && max.equalTags(x) { - t.setTagsFrom(id) - break - } - } - return t, nil -} diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go deleted file mode 100644 index 3c482886..00000000 --- a/vendor/golang.org/x/text/internal/language/parse.go +++ /dev/null @@ -1,594 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "bytes" - "errors" - "fmt" - "sort" - - "golang.org/x/text/internal/tag" -) - -// isAlpha returns true if the byte is not a digit. -// b must be an ASCII letter or digit. -func isAlpha(b byte) bool { - return b > '9' -} - -// isAlphaNum returns true if the string contains only ASCII letters or digits. -func isAlphaNum(s []byte) bool { - for _, c := range s { - if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { - return false - } - } - return true -} - -// ErrSyntax is returned by any of the parsing functions when the -// input is not well-formed, according to BCP 47. -// TODO: return the position at which the syntax error occurred? -var ErrSyntax = errors.New("language: tag is not well-formed") - -// ErrDuplicateKey is returned when a tag contains the same key twice with -// different values in the -u section. -var ErrDuplicateKey = errors.New("language: different values for same key in -u extension") - -// ValueError is returned by any of the parsing functions when the -// input is well-formed but the respective subtag is not recognized -// as a valid value. -type ValueError struct { - v [8]byte -} - -// NewValueError creates a new ValueError. -func NewValueError(tag []byte) ValueError { - var e ValueError - copy(e.v[:], tag) - return e -} - -func (e ValueError) tag() []byte { - n := bytes.IndexByte(e.v[:], 0) - if n == -1 { - n = 8 - } - return e.v[:n] -} - -// Error implements the error interface. -func (e ValueError) Error() string { - return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) -} - -// Subtag returns the subtag for which the error occurred. -func (e ValueError) Subtag() string { - return string(e.tag()) -} - -// scanner is used to scan BCP 47 tokens, which are separated by _ or -. -type scanner struct { - b []byte - bytes [max99thPercentileSize]byte - token []byte - start int // start position of the current token - end int // end position of the current token - next int // next point for scan - err error - done bool -} - -func makeScannerString(s string) scanner { - scan := scanner{} - if len(s) <= len(scan.bytes) { - scan.b = scan.bytes[:copy(scan.bytes[:], s)] - } else { - scan.b = []byte(s) - } - scan.init() - return scan -} - -// makeScanner returns a scanner using b as the input buffer. -// b is not copied and may be modified by the scanner routines. -func makeScanner(b []byte) scanner { - scan := scanner{b: b} - scan.init() - return scan -} - -func (s *scanner) init() { - for i, c := range s.b { - if c == '_' { - s.b[i] = '-' - } - } - s.scan() -} - -// restToLower converts the string between start and end to lower case. -func (s *scanner) toLower(start, end int) { - for i := start; i < end; i++ { - c := s.b[i] - if 'A' <= c && c <= 'Z' { - s.b[i] += 'a' - 'A' - } - } -} - -func (s *scanner) setError(e error) { - if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) { - s.err = e - } -} - -// resizeRange shrinks or grows the array at position oldStart such that -// a new string of size newSize can fit between oldStart and oldEnd. -// Sets the scan point to after the resized range. -func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { - s.start = oldStart - if end := oldStart + newSize; end != oldEnd { - diff := end - oldEnd - if end < cap(s.b) { - b := make([]byte, len(s.b)+diff) - copy(b, s.b[:oldStart]) - copy(b[end:], s.b[oldEnd:]) - s.b = b - } else { - s.b = append(s.b[end:], s.b[oldEnd:]...) - } - s.next = end + (s.next - s.end) - s.end = end - } -} - -// replace replaces the current token with repl. -func (s *scanner) replace(repl string) { - s.resizeRange(s.start, s.end, len(repl)) - copy(s.b[s.start:], repl) -} - -// gobble removes the current token from the input. -// Caller must call scan after calling gobble. -func (s *scanner) gobble(e error) { - s.setError(e) - if s.start == 0 { - s.b = s.b[:+copy(s.b, s.b[s.next:])] - s.end = 0 - } else { - s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] - s.end = s.start - 1 - } - s.next = s.start -} - -// deleteRange removes the given range from s.b before the current token. -func (s *scanner) deleteRange(start, end int) { - s.b = s.b[:start+copy(s.b[start:], s.b[end:])] - diff := end - start - s.next -= diff - s.start -= diff - s.end -= diff -} - -// scan parses the next token of a BCP 47 string. Tokens that are larger -// than 8 characters or include non-alphanumeric characters result in an error -// and are gobbled and removed from the output. -// It returns the end position of the last token consumed. -func (s *scanner) scan() (end int) { - end = s.end - s.token = nil - for s.start = s.next; s.next < len(s.b); { - i := bytes.IndexByte(s.b[s.next:], '-') - if i == -1 { - s.end = len(s.b) - s.next = len(s.b) - i = s.end - s.start - } else { - s.end = s.next + i - s.next = s.end + 1 - } - token := s.b[s.start:s.end] - if i < 1 || i > 8 || !isAlphaNum(token) { - s.gobble(ErrSyntax) - continue - } - s.token = token - return end - } - if n := len(s.b); n > 0 && s.b[n-1] == '-' { - s.setError(ErrSyntax) - s.b = s.b[:len(s.b)-1] - } - s.done = true - return end -} - -// acceptMinSize parses multiple tokens of the given size or greater. -// It returns the end position of the last token consumed. -func (s *scanner) acceptMinSize(min int) (end int) { - end = s.end - s.scan() - for ; len(s.token) >= min; s.scan() { - end = s.end - } - return end -} - -// Parse parses the given BCP 47 string and returns a valid Tag. If parsing -// failed it returns an error and any part of the tag that could be parsed. -// If parsing succeeded but an unknown value was found, it returns -// ValueError. The Tag returned in this case is just stripped of the unknown -// value. All other values are preserved. It accepts tags in the BCP 47 format -// and extensions to this standard defined in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -func Parse(s string) (t Tag, err error) { - // TODO: consider supporting old-style locale key-value pairs. - if s == "" { - return Und, ErrSyntax - } - if len(s) <= maxAltTaglen { - b := [maxAltTaglen]byte{} - for i, c := range s { - // Generating invalid UTF-8 is okay as it won't match. - if 'A' <= c && c <= 'Z' { - c += 'a' - 'A' - } else if c == '_' { - c = '-' - } - b[i] = byte(c) - } - if t, ok := grandfathered(b); ok { - return t, nil - } - } - scan := makeScannerString(s) - return parse(&scan, s) -} - -func parse(scan *scanner, s string) (t Tag, err error) { - t = Und - var end int - if n := len(scan.token); n <= 1 { - scan.toLower(0, len(scan.b)) - if n == 0 || scan.token[0] != 'x' { - return t, ErrSyntax - } - end = parseExtensions(scan) - } else if n >= 4 { - return Und, ErrSyntax - } else { // the usual case - t, end = parseTag(scan) - if n := len(scan.token); n == 1 { - t.pExt = uint16(end) - end = parseExtensions(scan) - } else if end < len(scan.b) { - scan.setError(ErrSyntax) - scan.b = scan.b[:end] - } - } - if int(t.pVariant) < len(scan.b) { - if end < len(s) { - s = s[:end] - } - if len(s) > 0 && tag.Compare(s, scan.b) == 0 { - t.str = s - } else { - t.str = string(scan.b) - } - } else { - t.pVariant, t.pExt = 0, 0 - } - return t, scan.err -} - -// parseTag parses language, script, region and variants. -// It returns a Tag and the end position in the input that was parsed. -func parseTag(scan *scanner) (t Tag, end int) { - var e error - // TODO: set an error if an unknown lang, script or region is encountered. - t.LangID, e = getLangID(scan.token) - scan.setError(e) - scan.replace(t.LangID.String()) - langStart := scan.start - end = scan.scan() - for len(scan.token) == 3 && isAlpha(scan.token[0]) { - // From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent - // to a tag of the form <extlang>. - lang, e := getLangID(scan.token) - if lang != 0 { - t.LangID = lang - copy(scan.b[langStart:], lang.String()) - scan.b[langStart+3] = '-' - scan.start = langStart + 4 - } - scan.gobble(e) - end = scan.scan() - } - if len(scan.token) == 4 && isAlpha(scan.token[0]) { - t.ScriptID, e = getScriptID(script, scan.token) - if t.ScriptID == 0 { - scan.gobble(e) - } - end = scan.scan() - } - if n := len(scan.token); n >= 2 && n <= 3 { - t.RegionID, e = getRegionID(scan.token) - if t.RegionID == 0 { - scan.gobble(e) - } else { - scan.replace(t.RegionID.String()) - } - end = scan.scan() - } - scan.toLower(scan.start, len(scan.b)) - t.pVariant = byte(end) - end = parseVariants(scan, end, t) - t.pExt = uint16(end) - return t, end -} - -var separator = []byte{'-'} - -// parseVariants scans tokens as long as each token is a valid variant string. -// Duplicate variants are removed. -func parseVariants(scan *scanner, end int, t Tag) int { - start := scan.start - varIDBuf := [4]uint8{} - variantBuf := [4][]byte{} - varID := varIDBuf[:0] - variant := variantBuf[:0] - last := -1 - needSort := false - for ; len(scan.token) >= 4; scan.scan() { - // TODO: measure the impact of needing this conversion and redesign - // the data structure if there is an issue. - v, ok := variantIndex[string(scan.token)] - if !ok { - // unknown variant - // TODO: allow user-defined variants? - scan.gobble(NewValueError(scan.token)) - continue - } - varID = append(varID, v) - variant = append(variant, scan.token) - if !needSort { - if last < int(v) { - last = int(v) - } else { - needSort = true - // There is no legal combinations of more than 7 variants - // (and this is by no means a useful sequence). - const maxVariants = 8 - if len(varID) > maxVariants { - break - } - } - } - end = scan.end - } - if needSort { - sort.Sort(variantsSort{varID, variant}) - k, l := 0, -1 - for i, v := range varID { - w := int(v) - if l == w { - // Remove duplicates. - continue - } - varID[k] = varID[i] - variant[k] = variant[i] - k++ - l = w - } - if str := bytes.Join(variant[:k], separator); len(str) == 0 { - end = start - 1 - } else { - scan.resizeRange(start, end, len(str)) - copy(scan.b[scan.start:], str) - end = scan.end - } - } - return end -} - -type variantsSort struct { - i []uint8 - v [][]byte -} - -func (s variantsSort) Len() int { - return len(s.i) -} - -func (s variantsSort) Swap(i, j int) { - s.i[i], s.i[j] = s.i[j], s.i[i] - s.v[i], s.v[j] = s.v[j], s.v[i] -} - -func (s variantsSort) Less(i, j int) bool { - return s.i[i] < s.i[j] -} - -type bytesSort struct { - b [][]byte - n int // first n bytes to compare -} - -func (b bytesSort) Len() int { - return len(b.b) -} - -func (b bytesSort) Swap(i, j int) { - b.b[i], b.b[j] = b.b[j], b.b[i] -} - -func (b bytesSort) Less(i, j int) bool { - for k := 0; k < b.n; k++ { - if b.b[i][k] == b.b[j][k] { - continue - } - return b.b[i][k] < b.b[j][k] - } - return false -} - -// parseExtensions parses and normalizes the extensions in the buffer. -// It returns the last position of scan.b that is part of any extension. -// It also trims scan.b to remove excess parts accordingly. -func parseExtensions(scan *scanner) int { - start := scan.start - exts := [][]byte{} - private := []byte{} - end := scan.end - for len(scan.token) == 1 { - extStart := scan.start - ext := scan.token[0] - end = parseExtension(scan) - extension := scan.b[extStart:end] - if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { - scan.setError(ErrSyntax) - end = extStart - continue - } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { - scan.b = scan.b[:end] - return end - } else if ext == 'x' { - private = extension - break - } - exts = append(exts, extension) - } - sort.Sort(bytesSort{exts, 1}) - if len(private) > 0 { - exts = append(exts, private) - } - scan.b = scan.b[:start] - if len(exts) > 0 { - scan.b = append(scan.b, bytes.Join(exts, separator)...) - } else if start > 0 { - // Strip trailing '-'. - scan.b = scan.b[:start-1] - } - return end -} - -// parseExtension parses a single extension and returns the position of -// the extension end. -func parseExtension(scan *scanner) int { - start, end := scan.start, scan.end - switch scan.token[0] { - case 'u': - attrStart := end - scan.scan() - for last := []byte{}; len(scan.token) > 2; scan.scan() { - if bytes.Compare(scan.token, last) != -1 { - // Attributes are unsorted. Start over from scratch. - p := attrStart + 1 - scan.next = p - attrs := [][]byte{} - for scan.scan(); len(scan.token) > 2; scan.scan() { - attrs = append(attrs, scan.token) - end = scan.end - } - sort.Sort(bytesSort{attrs, 3}) - copy(scan.b[p:], bytes.Join(attrs, separator)) - break - } - last = scan.token - end = scan.end - } - var last, key []byte - for attrEnd := end; len(scan.token) == 2; last = key { - key = scan.token - keyEnd := scan.end - end = scan.acceptMinSize(3) - // TODO: check key value validity - if keyEnd == end || bytes.Compare(key, last) != 1 { - // We have an invalid key or the keys are not sorted. - // Start scanning keys from scratch and reorder. - p := attrEnd + 1 - scan.next = p - keys := [][]byte{} - for scan.scan(); len(scan.token) == 2; { - keyStart, keyEnd := scan.start, scan.end - end = scan.acceptMinSize(3) - if keyEnd != end { - keys = append(keys, scan.b[keyStart:end]) - } else { - scan.setError(ErrSyntax) - end = keyStart - } - } - sort.Stable(bytesSort{keys, 2}) - if n := len(keys); n > 0 { - k := 0 - for i := 1; i < n; i++ { - if !bytes.Equal(keys[k][:2], keys[i][:2]) { - k++ - keys[k] = keys[i] - } else if !bytes.Equal(keys[k], keys[i]) { - scan.setError(ErrDuplicateKey) - } - } - keys = keys[:k+1] - } - reordered := bytes.Join(keys, separator) - if e := p + len(reordered); e < end { - scan.deleteRange(e, end) - end = e - } - copy(scan.b[p:], reordered) - break - } - } - case 't': - scan.scan() - if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { - _, end = parseTag(scan) - scan.toLower(start, end) - } - for len(scan.token) == 2 && !isAlpha(scan.token[1]) { - end = scan.acceptMinSize(3) - } - case 'x': - end = scan.acceptMinSize(1) - default: - end = scan.acceptMinSize(2) - } - return end -} - -// getExtension returns the name, body and end position of the extension. -func getExtension(s string, p int) (end int, ext string) { - if s[p] == '-' { - p++ - } - if s[p] == 'x' { - return len(s), s[p:] - } - end = nextExtension(s, p) - return end, s[p:end] -} - -// nextExtension finds the next extension within the string, searching -// for the -<char>- pattern from position p. -// In the fast majority of cases, language tags will have at most -// one extension and extensions tend to be small. -func nextExtension(s string, p int) int { - for n := len(s) - 3; p < n; { - if s[p] == '-' { - if s[p+2] == '-' { - return p - } - p += 3 - } else { - p++ - } - } - return len(s) -} diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go deleted file mode 100644 index 239e2d29..00000000 --- a/vendor/golang.org/x/text/internal/language/tables.go +++ /dev/null @@ -1,3431 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -import "golang.org/x/text/internal/tag" - -// CLDRVersion is the CLDR version from which the tables in this package are derived. -const CLDRVersion = "32" - -const NumLanguages = 8665 - -const NumScripts = 242 - -const NumRegions = 357 - -type FromTo struct { - From uint16 - To uint16 -} - -const nonCanonicalUnd = 1201 -const ( - _af = 22 - _am = 39 - _ar = 58 - _az = 88 - _bg = 126 - _bn = 165 - _ca = 215 - _cs = 250 - _da = 257 - _de = 269 - _el = 310 - _en = 313 - _es = 318 - _et = 320 - _fa = 328 - _fi = 337 - _fil = 339 - _fr = 350 - _gu = 420 - _he = 444 - _hi = 446 - _hr = 465 - _hu = 469 - _hy = 471 - _id = 481 - _is = 504 - _it = 505 - _ja = 512 - _ka = 528 - _kk = 578 - _km = 586 - _kn = 593 - _ko = 596 - _ky = 650 - _lo = 696 - _lt = 704 - _lv = 711 - _mk = 767 - _ml = 772 - _mn = 779 - _mo = 784 - _mr = 795 - _ms = 799 - _mul = 806 - _my = 817 - _nb = 839 - _ne = 849 - _nl = 871 - _no = 879 - _pa = 925 - _pl = 947 - _pt = 960 - _ro = 988 - _ru = 994 - _sh = 1031 - _si = 1036 - _sk = 1042 - _sl = 1046 - _sq = 1073 - _sr = 1074 - _sv = 1092 - _sw = 1093 - _ta = 1104 - _te = 1121 - _th = 1131 - _tl = 1146 - _tn = 1152 - _tr = 1162 - _uk = 1198 - _ur = 1204 - _uz = 1212 - _vi = 1219 - _zh = 1321 - _zu = 1327 - _jbo = 515 - _ami = 1650 - _bnn = 2357 - _hak = 438 - _tlh = 14467 - _lb = 661 - _nv = 899 - _pwn = 12055 - _tao = 14188 - _tay = 14198 - _tsu = 14662 - _nn = 874 - _sfb = 13629 - _vgt = 15701 - _sgg = 13660 - _cmn = 3007 - _nan = 835 - _hsn = 467 -) - -const langPrivateStart = 0x2f72 - -const langPrivateEnd = 0x3179 - -// lang holds an alphabetically sorted list of ISO-639 language identifiers. -// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. -// For 2-byte language identifiers, the two successive bytes have the following meaning: -// - if the first letter of the 2- and 3-letter ISO codes are the same: -// the second and third letter of the 3-letter ISO code. -// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. -// For 3-byte language identifiers the 4th byte is 0. -const lang tag.Index = "" + // Size: 5324 bytes - "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + - "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + - "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + - "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + - "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + - "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + - "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + - "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + - "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + - "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + - "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + - "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + - "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + - "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + - "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + - "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + - "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + - "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + - "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + - "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + - "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + - "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + - "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + - "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + - "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + - "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + - "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + - "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + - "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + - "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + - "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + - "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + - "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + - "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + - "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + - "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + - "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + - "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + - "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + - "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + - "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + - "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + - "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + - "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + - "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + - "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + - "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + - "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + - "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + - "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + - "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + - "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + - "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + - "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + - "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + - "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + - "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + - "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + - "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + - "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + - "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + - "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + - "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + - "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + - "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + - "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + - "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + - "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + - "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + - "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + - "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + - "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + - "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + - "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + - "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + - "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + - "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + - "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + - "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + - "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + - "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + - "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + - "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + - "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + - "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + - "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + - "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + - "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + - "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + - "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + - "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + - "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + - "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + - "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + - "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + - "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + - "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + - "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + - "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + - "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + - "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + - "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + - "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + - "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + - "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + - "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + - "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + - "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + - "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + - "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + - "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + - "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + - "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + - "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + - "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + - "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + - "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + - "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + - "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + - "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + - "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + - "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + - "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + - "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" - -const langNoIndexOffset = 1330 - -// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index -// in lookup tables. The language ids for these language codes are derived directly -// from the letters and are not consecutive. -// Size: 2197 bytes, 2197 elements -var langNoIndex = [2197]uint8{ - // Entry 0 - 3F - 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, - 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, - 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, - 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, - 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, - 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a, - 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, - // Entry 40 - 7F - 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, - 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, - 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, - 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, - 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, - 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, - 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, - 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, - // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff, - 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, - 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, - 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, - 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, - 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, - 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, - 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, - // Entry C0 - FF - 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, - 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef, - 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, - 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35, - 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, - // Entry 100 - 13F - 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, - 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, - 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, - 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c, - 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f, - 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, - 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, - // Entry 140 - 17F - 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16, - 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, - 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09, - 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, - 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04, - 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, - 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03, - // Entry 180 - 1BF - 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, - 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, - // Entry 1C0 - 1FF - 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, - 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, - 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, - 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, - // Entry 200 - 23F - 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, - 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, - 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf, - 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3, - 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, - 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, - 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, - // Entry 240 - 27F - 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, - 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0, - 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, - 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, - 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, - 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, - 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66, - // Entry 280 - 2BF - 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, - 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, - 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, - 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, - 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, - 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, - 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, - // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, - 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, - 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, - 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, - 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, - 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00, - // Entry 300 - 33F - 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, - 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, - 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, - 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0, - 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, - 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, - 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, - // Entry 340 - 37F - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, - 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, - 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, - 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, - 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, - 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, - 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, - 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, - // Entry 380 - 3BF - 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, - 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, - 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, - 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, - 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, - 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, - 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, - // Entry 3C0 - 3FF - 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, - 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01, - 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10, - 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, - 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, - // Entry 400 - 43F - 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, - 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, - 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, - 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, - 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, - 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, - 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, - 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, - // Entry 440 - 47F - 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, - 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, - 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, - 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, - 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, - 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd, - 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, - 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, - // Entry 480 - 4BF - 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb, - 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05, - 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04, - 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1, - // Entry 4C0 - 4FF - 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed, - 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, - 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, - 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7, - 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, - 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, - 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, - // Entry 500 - 53F - 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, - 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, - 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7, - 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, - 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, - 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, - 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, - // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - // Entry 580 - 5BF - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, - 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, - 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, - 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, - 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, - 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, - // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, - 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, - 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, - 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20, - 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, - 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, - 0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe, - // Entry 600 - 63F - 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, - 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, - 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, - 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, - 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f, - 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, - 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18, - 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, - // Entry 640 - 67F - 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c, - 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, - 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98, - 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, - 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4, - 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, - 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, - // Entry 680 - 6BF - 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda, - 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0, - 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, - 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, - 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, - 0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f, - // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, - 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41, - 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, - 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, - 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, - // Entry 700 - 73F - 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, - 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79, - 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, - 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 740 - 77F - 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, - 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, - 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, - 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55, - 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03, - 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, - // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, - 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, - 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, - 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, - 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, - // Entry 7C0 - 7FF - 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42, - 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56, - 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, - 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, - 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, - 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, - 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, - // Entry 800 - 83F - 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, - 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, - 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, - 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, - 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, - 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, - 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, - // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, - 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, - 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1, - 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, - 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, - 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, - // Entry 880 - 8BF - 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, - 0x0a, 0x00, 0x80, 0x00, 0x00, -} - -// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives -// to 2-letter language codes that cannot be derived using the method described above. -// Each 3-letter code is followed by its 1-byte langID. -const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" - -// altLangIndex is used to convert indexes in altLangISO3 to langIDs. -// Size: 12 bytes, 6 elements -var altLangIndex = [6]uint16{ - 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, -} - -// AliasMap maps langIDs to their suggested replacements. -// Size: 656 bytes, 164 elements -var AliasMap = [164]FromTo{ - 0: {From: 0x82, To: 0x88}, - 1: {From: 0x187, To: 0x1ae}, - 2: {From: 0x1f3, To: 0x1e1}, - 3: {From: 0x1fb, To: 0x1bc}, - 4: {From: 0x208, To: 0x512}, - 5: {From: 0x20f, To: 0x20e}, - 6: {From: 0x310, To: 0x3dc}, - 7: {From: 0x347, To: 0x36f}, - 8: {From: 0x407, To: 0x432}, - 9: {From: 0x47a, To: 0x153}, - 10: {From: 0x490, To: 0x451}, - 11: {From: 0x4a2, To: 0x21}, - 12: {From: 0x53e, To: 0x544}, - 13: {From: 0x58f, To: 0x12d}, - 14: {From: 0x630, To: 0x1eb1}, - 15: {From: 0x651, To: 0x431}, - 16: {From: 0x662, To: 0x431}, - 17: {From: 0x6ed, To: 0x3a}, - 18: {From: 0x6f8, To: 0x1d7}, - 19: {From: 0x73e, To: 0x21a1}, - 20: {From: 0x7b3, To: 0x56}, - 21: {From: 0x7b9, To: 0x299b}, - 22: {From: 0x7c5, To: 0x58}, - 23: {From: 0x7e6, To: 0x145}, - 24: {From: 0x80c, To: 0x5a}, - 25: {From: 0x815, To: 0x8d}, - 26: {From: 0x87e, To: 0x810}, - 27: {From: 0x8c3, To: 0xee3}, - 28: {From: 0x9ef, To: 0x331}, - 29: {From: 0xa36, To: 0x2c5}, - 30: {From: 0xa3d, To: 0xbf}, - 31: {From: 0xabe, To: 0x3322}, - 32: {From: 0xb38, To: 0x529}, - 33: {From: 0xb75, To: 0x265a}, - 34: {From: 0xb7e, To: 0xbc3}, - 35: {From: 0xb9b, To: 0x44e}, - 36: {From: 0xbbc, To: 0x4229}, - 37: {From: 0xbbf, To: 0x529}, - 38: {From: 0xbfe, To: 0x2da7}, - 39: {From: 0xc2e, To: 0x3181}, - 40: {From: 0xcb9, To: 0xf3}, - 41: {From: 0xd08, To: 0xfa}, - 42: {From: 0xdc8, To: 0x11a}, - 43: {From: 0xdd7, To: 0x32d}, - 44: {From: 0xdf8, To: 0xdfb}, - 45: {From: 0xdfe, To: 0x531}, - 46: {From: 0xedf, To: 0x205a}, - 47: {From: 0xeee, To: 0x2e9a}, - 48: {From: 0xf39, To: 0x367}, - 49: {From: 0x10d0, To: 0x140}, - 50: {From: 0x1104, To: 0x2d0}, - 51: {From: 0x11a0, To: 0x1ec}, - 52: {From: 0x1279, To: 0x21}, - 53: {From: 0x1424, To: 0x15e}, - 54: {From: 0x1470, To: 0x14e}, - 55: {From: 0x151f, To: 0xd9b}, - 56: {From: 0x1523, To: 0x390}, - 57: {From: 0x1532, To: 0x19f}, - 58: {From: 0x1580, To: 0x210}, - 59: {From: 0x1583, To: 0x10d}, - 60: {From: 0x15a3, To: 0x3caf}, - 61: {From: 0x166a, To: 0x19b}, - 62: {From: 0x16c8, To: 0x136}, - 63: {From: 0x1700, To: 0x29f8}, - 64: {From: 0x1718, To: 0x194}, - 65: {From: 0x1727, To: 0xf3f}, - 66: {From: 0x177a, To: 0x178}, - 67: {From: 0x1809, To: 0x17b6}, - 68: {From: 0x1816, To: 0x18f3}, - 69: {From: 0x188a, To: 0x436}, - 70: {From: 0x1979, To: 0x1d01}, - 71: {From: 0x1a74, To: 0x2bb0}, - 72: {From: 0x1a8a, To: 0x1f8}, - 73: {From: 0x1b5a, To: 0x1fa}, - 74: {From: 0x1b86, To: 0x1515}, - 75: {From: 0x1d64, To: 0x2c9b}, - 76: {From: 0x2038, To: 0x37b1}, - 77: {From: 0x203d, To: 0x20dd}, - 78: {From: 0x205a, To: 0x30b}, - 79: {From: 0x20e3, To: 0x274}, - 80: {From: 0x20ee, To: 0x263}, - 81: {From: 0x20f2, To: 0x22d}, - 82: {From: 0x20f9, To: 0x256}, - 83: {From: 0x210f, To: 0x21eb}, - 84: {From: 0x2135, To: 0x27d}, - 85: {From: 0x2160, To: 0x913}, - 86: {From: 0x2199, To: 0x121}, - 87: {From: 0x21ce, To: 0x1561}, - 88: {From: 0x21e6, To: 0x504}, - 89: {From: 0x21f4, To: 0x49f}, - 90: {From: 0x222d, To: 0x121}, - 91: {From: 0x2237, To: 0x121}, - 92: {From: 0x2262, To: 0x92a}, - 93: {From: 0x2316, To: 0x3226}, - 94: {From: 0x2382, To: 0x3365}, - 95: {From: 0x2472, To: 0x2c7}, - 96: {From: 0x24e4, To: 0x2ff}, - 97: {From: 0x24f0, To: 0x2fa}, - 98: {From: 0x24fa, To: 0x31f}, - 99: {From: 0x2550, To: 0xb5b}, - 100: {From: 0x25a9, To: 0xe2}, - 101: {From: 0x263e, To: 0x2d0}, - 102: {From: 0x26c9, To: 0x26b4}, - 103: {From: 0x26f9, To: 0x3c8}, - 104: {From: 0x2727, To: 0x3caf}, - 105: {From: 0x2765, To: 0x26b4}, - 106: {From: 0x2789, To: 0x4358}, - 107: {From: 0x28ef, To: 0x2837}, - 108: {From: 0x2914, To: 0x351}, - 109: {From: 0x2986, To: 0x2da7}, - 110: {From: 0x2b1a, To: 0x38d}, - 111: {From: 0x2bfc, To: 0x395}, - 112: {From: 0x2c3f, To: 0x3caf}, - 113: {From: 0x2cfc, To: 0x3be}, - 114: {From: 0x2d13, To: 0x597}, - 115: {From: 0x2d47, To: 0x148}, - 116: {From: 0x2d48, To: 0x148}, - 117: {From: 0x2dff, To: 0x2f1}, - 118: {From: 0x2e08, To: 0x19cc}, - 119: {From: 0x2e1a, To: 0x2d95}, - 120: {From: 0x2e21, To: 0x292}, - 121: {From: 0x2e54, To: 0x7d}, - 122: {From: 0x2e65, To: 0x2282}, - 123: {From: 0x2ea0, To: 0x2e9b}, - 124: {From: 0x2eef, To: 0x2ed7}, - 125: {From: 0x3193, To: 0x3c4}, - 126: {From: 0x3366, To: 0x338e}, - 127: {From: 0x342a, To: 0x3dc}, - 128: {From: 0x34ee, To: 0x18d0}, - 129: {From: 0x35c8, To: 0x2c9b}, - 130: {From: 0x35e6, To: 0x412}, - 131: {From: 0x3658, To: 0x246}, - 132: {From: 0x3676, To: 0x3f4}, - 133: {From: 0x36fd, To: 0x445}, - 134: {From: 0x37c0, To: 0x121}, - 135: {From: 0x3816, To: 0x38f2}, - 136: {From: 0x382b, To: 0x2c9b}, - 137: {From: 0x382f, To: 0xa9}, - 138: {From: 0x3832, To: 0x3228}, - 139: {From: 0x386c, To: 0x39a6}, - 140: {From: 0x3892, To: 0x3fc0}, - 141: {From: 0x38a5, To: 0x39d7}, - 142: {From: 0x38b4, To: 0x1fa4}, - 143: {From: 0x38b5, To: 0x2e9a}, - 144: {From: 0x395c, To: 0x47e}, - 145: {From: 0x3b4e, To: 0xd91}, - 146: {From: 0x3b78, To: 0x137}, - 147: {From: 0x3c99, To: 0x4bc}, - 148: {From: 0x3fbd, To: 0x100}, - 149: {From: 0x4208, To: 0xa91}, - 150: {From: 0x42be, To: 0x573}, - 151: {From: 0x42f9, To: 0x3f60}, - 152: {From: 0x4378, To: 0x25a}, - 153: {From: 0x43cb, To: 0x36cb}, - 154: {From: 0x43cd, To: 0x10f}, - 155: {From: 0x44af, To: 0x3322}, - 156: {From: 0x44e3, To: 0x512}, - 157: {From: 0x45ca, To: 0x2409}, - 158: {From: 0x45dd, To: 0x26dc}, - 159: {From: 0x4610, To: 0x48ae}, - 160: {From: 0x46ae, To: 0x46a0}, - 161: {From: 0x473e, To: 0x4745}, - 162: {From: 0x4916, To: 0x31f}, - 163: {From: 0x49a7, To: 0x523}, -} - -// Size: 164 bytes, 164 elements -var AliasTypes = [164]AliasType{ - // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0, - 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0, - 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0, - // Entry 40 - 7F - 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1, - 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, - 2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, - 0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, - // Entry 80 - BF - 0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, - 1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, - 0, 1, 1, 1, -} - -const ( - _Latn = 87 - _Hani = 54 - _Hans = 56 - _Hant = 57 - _Qaaa = 139 - _Qaai = 147 - _Qabx = 188 - _Zinh = 236 - _Zyyy = 241 - _Zzzz = 242 -) - -// script is an alphabetically sorted list of ISO 15924 codes. The index -// of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 976 bytes - "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + - "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" + - "DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" + - "HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" + - "KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" + - "LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" + - "ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" + - "OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" + - "QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" + - "QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" + - "QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" + - "ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" + - "TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" + - "YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" - -// suppressScript is an index from langID to the dominant script for that language, -// if it exists. If a script is given, it should be suppressed from the language tag. -// Size: 1330 bytes, 1330 elements -var suppressScript = [1330]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 40 - 7F - 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, - // Entry 80 - BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry C0 - FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 100 - 13F - 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00, - // Entry 140 - 17F - 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 180 - 1BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00, - // Entry 1C0 - 1FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, - // Entry 200 - 23F - 0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 240 - 27F - 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 280 - 2BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 2C0 - 2FF - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, - // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, - // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, - // Entry 3C0 - 3FF - 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 400 - 43F - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, - // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, - // Entry 480 - 4BF - 0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 4C0 - 4FF - 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 500 - 53F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, -} - -const ( - _001 = 1 - _419 = 31 - _BR = 65 - _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 -) - -// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID -// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for -// the UN.M49 codes used for groups.) -const isoRegionOffset = 32 - -// regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 40 - 7F - 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 80 - BF - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, -} - -// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. -// Each 2-letter codes is followed by two bytes with the following meaning: -// - [A-Z}{2}: the first letter of the 2-letter code plus these two -// letters form the 3-letter ISO code. -// - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes - "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + - "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + - "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" - -// altRegionISO3 holds a list of 3-letter region codes that cannot be -// mapped to 2-letter codes using the default algorithm. This is a short list. -const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" - -// altRegionIDs holds a list of regionIDs the positions of which match those -// of the 3-letter ISO codes in altRegionISO3. -// Size: 22 bytes, 11 elements -var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, -} - -// Size: 80 bytes, 20 elements -var regionOldMap = [20]FromTo{ - 0: {From: 0x44, To: 0xc4}, - 1: {From: 0x58, To: 0xa7}, - 2: {From: 0x5f, To: 0x60}, - 3: {From: 0x66, To: 0x3b}, - 4: {From: 0x79, To: 0x78}, - 5: {From: 0x93, To: 0x37}, - 6: {From: 0xa3, To: 0x133}, - 7: {From: 0xc1, To: 0x133}, - 8: {From: 0xd7, To: 0x13f}, - 9: {From: 0xdc, To: 0x2b}, - 10: {From: 0xef, To: 0x133}, - 11: {From: 0xf2, To: 0xe2}, - 12: {From: 0xfc, To: 0x70}, - 13: {From: 0x103, To: 0x164}, - 14: {From: 0x12a, To: 0x126}, - 15: {From: 0x132, To: 0x7b}, - 16: {From: 0x13a, To: 0x13e}, - 17: {From: 0x141, To: 0x133}, - 18: {From: 0x15d, To: 0x15e}, - 19: {From: 0x163, To: 0x4b}, -} - -// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are -// codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ - // Entry 0 - 3F - 0, 1, 2, 3, 5, 9, 11, 13, - 14, 15, 17, 18, 19, 21, 29, 30, - 34, 35, 39, 53, 54, 57, 61, 142, - 143, 145, 150, 151, 154, 155, 202, 419, - 958, 0, 20, 784, 4, 28, 660, 8, - 51, 530, 24, 10, 32, 16, 40, 36, - 533, 248, 31, 70, 52, 50, 56, 854, - 100, 48, 108, 204, 652, 60, 96, 68, - // Entry 40 - 7F - 535, 76, 44, 64, 104, 74, 72, 112, - 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, - // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, - // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, - // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, - // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, -} - -// m49Index gives indexes into fromM49 based on the three most significant bits -// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in -// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] -// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. -// The region code is stored in the 9 lsb of the indexed value. -// Size: 18 bytes, 9 elements -var m49Index = [9]int16{ - 0, 59, 108, 143, 181, 220, 259, 291, - 333, -} - -// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. -// Size: 666 bytes, 333 elements -var fromM49 = [333]uint16{ - // Entry 0 - 3F - 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, - 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, - 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, - 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, - 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, - // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, - // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, - // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, - // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, - // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, -} - -// Size: 1615 bytes -var variantIndex = map[string]uint8{ - "1606nict": 0x0, - "1694acad": 0x1, - "1901": 0x2, - "1959acad": 0x3, - "1994": 0x4d, - "1996": 0x4, - "abl1943": 0x5, - "akuapem": 0x6, - "alalc97": 0x4f, - "aluku": 0x7, - "ao1990": 0x8, - "arevela": 0x9, - "arevmda": 0xa, - "asante": 0xb, - "baku1926": 0xc, - "balanka": 0xd, - "barla": 0xe, - "basiceng": 0xf, - "bauddha": 0x10, - "biscayan": 0x11, - "biske": 0x48, - "bohoric": 0x12, - "boont": 0x13, - "colb1945": 0x14, - "cornu": 0x15, - "dajnko": 0x16, - "ekavsk": 0x17, - "emodeng": 0x18, - "fonipa": 0x50, - "fonnapa": 0x51, - "fonupa": 0x52, - "fonxsamp": 0x53, - "hepburn": 0x19, - "heploc": 0x4e, - "hognorsk": 0x1a, - "hsistemo": 0x1b, - "ijekavsk": 0x1c, - "itihasa": 0x1d, - "jauer": 0x1e, - "jyutping": 0x1f, - "kkcor": 0x20, - "kociewie": 0x21, - "kscor": 0x22, - "laukika": 0x23, - "lipaw": 0x49, - "luna1918": 0x24, - "metelko": 0x25, - "monoton": 0x26, - "ndyuka": 0x27, - "nedis": 0x28, - "newfound": 0x29, - "njiva": 0x4a, - "nulik": 0x2a, - "osojs": 0x4b, - "oxendict": 0x2b, - "pahawh2": 0x2c, - "pahawh3": 0x2d, - "pahawh4": 0x2e, - "pamaka": 0x2f, - "petr1708": 0x30, - "pinyin": 0x31, - "polyton": 0x32, - "puter": 0x33, - "rigik": 0x34, - "rozaj": 0x35, - "rumgr": 0x36, - "scotland": 0x37, - "scouse": 0x38, - "simple": 0x54, - "solba": 0x4c, - "sotav": 0x39, - "spanglis": 0x3a, - "surmiran": 0x3b, - "sursilv": 0x3c, - "sutsilv": 0x3d, - "tarask": 0x3e, - "uccor": 0x3f, - "ucrcor": 0x40, - "ulster": 0x41, - "unifon": 0x42, - "vaidika": 0x43, - "valencia": 0x44, - "vallader": 0x45, - "wadegile": 0x46, - "xsistemo": 0x47, -} - -// variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 79 - -// nRegionGroups is the number of region groups. -const nRegionGroups = 33 - -type likelyLangRegion struct { - lang uint16 - region uint16 -} - -// likelyScript is a lookup table, indexed by scriptID, for the most likely -// languages and regions given a script. -// Size: 976 bytes, 244 elements -var likelyScript = [244]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x84}, - 3: {lang: 0x2a2, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, - 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, - 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, - 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x99}, - 17: {lang: 0x529, region: 0x12e}, - 18: {lang: 0x3b1, region: 0x99}, - 19: {lang: 0x15e, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, - 22: {lang: 0xdb, region: 0x35}, - 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 28: {lang: 0xf1, region: 0x6b}, - 30: {lang: 0x1a0, region: 0x5d}, - 31: {lang: 0x3e2, region: 0x106}, - 33: {lang: 0x1be, region: 0x99}, - 36: {lang: 0x15e, region: 0x78}, - 39: {lang: 0x133, region: 0x6b}, - 40: {lang: 0x431, region: 0x27}, - 41: {lang: 0x27, region: 0x6f}, - 43: {lang: 0x210, region: 0x7d}, - 44: {lang: 0xfe, region: 0x38}, - 46: {lang: 0x19b, region: 0x99}, - 47: {lang: 0x19e, region: 0x130}, - 48: {lang: 0x3e9, region: 0x99}, - 49: {lang: 0x136, region: 0x87}, - 50: {lang: 0x1a4, region: 0x99}, - 51: {lang: 0x39d, region: 0x99}, - 52: {lang: 0x529, region: 0x12e}, - 53: {lang: 0x254, region: 0xab}, - 54: {lang: 0x529, region: 0x53}, - 55: {lang: 0x1cb, region: 0xe7}, - 56: {lang: 0x529, region: 0x53}, - 57: {lang: 0x529, region: 0x12e}, - 58: {lang: 0x2fd, region: 0x9b}, - 59: {lang: 0x1bc, region: 0x97}, - 60: {lang: 0x200, region: 0xa2}, - 61: {lang: 0x1c5, region: 0x12b}, - 62: {lang: 0x1ca, region: 0xaf}, - 65: {lang: 0x1d5, region: 0x92}, - 67: {lang: 0x142, region: 0x9e}, - 68: {lang: 0x254, region: 0xab}, - 69: {lang: 0x20e, region: 0x95}, - 70: {lang: 0x200, region: 0xa2}, - 72: {lang: 0x135, region: 0xc4}, - 73: {lang: 0x200, region: 0xa2}, - 74: {lang: 0x3bb, region: 0xe8}, - 75: {lang: 0x24a, region: 0xa6}, - 76: {lang: 0x3fa, region: 0x99}, - 79: {lang: 0x251, region: 0x99}, - 80: {lang: 0x254, region: 0xab}, - 82: {lang: 0x88, region: 0x99}, - 83: {lang: 0x370, region: 0x123}, - 84: {lang: 0x2b8, region: 0xaf}, - 89: {lang: 0x29f, region: 0x99}, - 90: {lang: 0x2a8, region: 0x99}, - 91: {lang: 0x28f, region: 0x87}, - 92: {lang: 0x1a0, region: 0x87}, - 93: {lang: 0x2ac, region: 0x53}, - 95: {lang: 0x4f4, region: 0x12b}, - 96: {lang: 0x4f5, region: 0x12b}, - 97: {lang: 0x1be, region: 0x99}, - 99: {lang: 0x337, region: 0x9c}, - 100: {lang: 0x4f7, region: 0x53}, - 101: {lang: 0xa9, region: 0x53}, - 104: {lang: 0x2e8, region: 0x112}, - 105: {lang: 0x4f8, region: 0x10b}, - 106: {lang: 0x4f8, region: 0x10b}, - 107: {lang: 0x304, region: 0x99}, - 108: {lang: 0x31b, region: 0x99}, - 109: {lang: 0x30b, region: 0x53}, - 111: {lang: 0x31e, region: 0x35}, - 112: {lang: 0x30e, region: 0x99}, - 113: {lang: 0x414, region: 0xe8}, - 114: {lang: 0x331, region: 0xc4}, - 115: {lang: 0x4f9, region: 0x108}, - 116: {lang: 0x3b, region: 0xa1}, - 117: {lang: 0x353, region: 0xdb}, - 120: {lang: 0x2d0, region: 0x84}, - 121: {lang: 0x52a, region: 0x53}, - 122: {lang: 0x403, region: 0x96}, - 123: {lang: 0x3ee, region: 0x99}, - 124: {lang: 0x39b, region: 0xc5}, - 125: {lang: 0x395, region: 0x99}, - 126: {lang: 0x399, region: 0x135}, - 127: {lang: 0x429, region: 0x115}, - 128: {lang: 0x3b, region: 0x11c}, - 129: {lang: 0xfd, region: 0xc4}, - 130: {lang: 0x27d, region: 0x106}, - 131: {lang: 0x2c9, region: 0x53}, - 132: {lang: 0x39f, region: 0x9c}, - 133: {lang: 0x39f, region: 0x53}, - 135: {lang: 0x3ad, region: 0xb0}, - 137: {lang: 0x1c6, region: 0x53}, - 138: {lang: 0x4fd, region: 0x9c}, - 189: {lang: 0x3cb, region: 0x95}, - 191: {lang: 0x372, region: 0x10c}, - 192: {lang: 0x420, region: 0x97}, - 194: {lang: 0x4ff, region: 0x15e}, - 195: {lang: 0x3f0, region: 0x99}, - 196: {lang: 0x45, region: 0x135}, - 197: {lang: 0x139, region: 0x7b}, - 198: {lang: 0x3e9, region: 0x99}, - 200: {lang: 0x3e9, region: 0x99}, - 201: {lang: 0x3fa, region: 0x99}, - 202: {lang: 0x40c, region: 0xb3}, - 203: {lang: 0x433, region: 0x99}, - 204: {lang: 0xef, region: 0xc5}, - 205: {lang: 0x43e, region: 0x95}, - 206: {lang: 0x44d, region: 0x35}, - 207: {lang: 0x44e, region: 0x9b}, - 211: {lang: 0x45a, region: 0xe7}, - 212: {lang: 0x11a, region: 0x99}, - 213: {lang: 0x45e, region: 0x53}, - 214: {lang: 0x232, region: 0x53}, - 215: {lang: 0x450, region: 0x99}, - 216: {lang: 0x4a5, region: 0x53}, - 217: {lang: 0x9f, region: 0x13e}, - 218: {lang: 0x461, region: 0x99}, - 220: {lang: 0x528, region: 0xba}, - 221: {lang: 0x153, region: 0xe7}, - 222: {lang: 0x128, region: 0xcd}, - 223: {lang: 0x46b, region: 0x123}, - 224: {lang: 0xa9, region: 0x53}, - 225: {lang: 0x2ce, region: 0x99}, - 226: {lang: 0x4ad, region: 0x11c}, - 227: {lang: 0x4be, region: 0xb4}, - 229: {lang: 0x1ce, region: 0x99}, - 232: {lang: 0x3a9, region: 0x9c}, - 233: {lang: 0x22, region: 0x9b}, - 234: {lang: 0x1ea, region: 0x53}, - 235: {lang: 0xef, region: 0xc5}, -} - -type likelyScriptRegion struct { - region uint16 - script uint8 - flags uint8 -} - -// likelyLang is a lookup table, indexed by langID, for the most likely -// scripts and regions given incomplete information. If more entries exist for a -// given language, region and script are the index and size respectively -// of the list in likelyLangList. -// Size: 5320 bytes, 1330 elements -var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x135, script: 0x57, flags: 0x0}, - 1: {region: 0x6f, script: 0x57, flags: 0x0}, - 2: {region: 0x165, script: 0x57, flags: 0x0}, - 3: {region: 0x165, script: 0x57, flags: 0x0}, - 4: {region: 0x165, script: 0x57, flags: 0x0}, - 5: {region: 0x7d, script: 0x1f, flags: 0x0}, - 6: {region: 0x165, script: 0x57, flags: 0x0}, - 7: {region: 0x165, script: 0x1f, flags: 0x0}, - 8: {region: 0x80, script: 0x57, flags: 0x0}, - 9: {region: 0x165, script: 0x57, flags: 0x0}, - 10: {region: 0x165, script: 0x57, flags: 0x0}, - 11: {region: 0x165, script: 0x57, flags: 0x0}, - 12: {region: 0x95, script: 0x57, flags: 0x0}, - 13: {region: 0x131, script: 0x57, flags: 0x0}, - 14: {region: 0x80, script: 0x57, flags: 0x0}, - 15: {region: 0x165, script: 0x57, flags: 0x0}, - 16: {region: 0x165, script: 0x57, flags: 0x0}, - 17: {region: 0x106, script: 0x1f, flags: 0x0}, - 18: {region: 0x165, script: 0x57, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x57, flags: 0x0}, - 22: {region: 0x161, script: 0x57, flags: 0x0}, - 23: {region: 0x165, script: 0x57, flags: 0x0}, - 24: {region: 0x165, script: 0x57, flags: 0x0}, - 25: {region: 0x165, script: 0x57, flags: 0x0}, - 26: {region: 0x165, script: 0x57, flags: 0x0}, - 27: {region: 0x165, script: 0x57, flags: 0x0}, - 28: {region: 0x52, script: 0x57, flags: 0x0}, - 29: {region: 0x165, script: 0x57, flags: 0x0}, - 30: {region: 0x165, script: 0x57, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x57, flags: 0x0}, - 33: {region: 0x80, script: 0x57, flags: 0x0}, - 34: {region: 0x9b, script: 0xe9, flags: 0x0}, - 35: {region: 0x165, script: 0x57, flags: 0x0}, - 36: {region: 0x165, script: 0x57, flags: 0x0}, - 37: {region: 0x14d, script: 0x57, flags: 0x0}, - 38: {region: 0x106, script: 0x1f, flags: 0x0}, - 39: {region: 0x6f, script: 0x29, flags: 0x0}, - 40: {region: 0x165, script: 0x57, flags: 0x0}, - 41: {region: 0x165, script: 0x57, flags: 0x0}, - 42: {region: 0xd6, script: 0x57, flags: 0x0}, - 43: {region: 0x165, script: 0x57, flags: 0x0}, - 45: {region: 0x165, script: 0x57, flags: 0x0}, - 46: {region: 0x165, script: 0x57, flags: 0x0}, - 47: {region: 0x165, script: 0x57, flags: 0x0}, - 48: {region: 0x165, script: 0x57, flags: 0x0}, - 49: {region: 0x165, script: 0x57, flags: 0x0}, - 50: {region: 0x165, script: 0x57, flags: 0x0}, - 51: {region: 0x95, script: 0x57, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x57, flags: 0x0}, - 55: {region: 0x165, script: 0x57, flags: 0x0}, - 56: {region: 0x165, script: 0x57, flags: 0x0}, - 57: {region: 0x165, script: 0x57, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, - 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x57, flags: 0x0}, - 61: {region: 0x51, script: 0x57, flags: 0x0}, - 62: {region: 0x3f, script: 0x57, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x57, flags: 0x0}, - 69: {region: 0x135, script: 0xc4, flags: 0x0}, - 70: {region: 0x165, script: 0x57, flags: 0x0}, - 71: {region: 0x165, script: 0x57, flags: 0x0}, - 72: {region: 0x6e, script: 0x57, flags: 0x0}, - 73: {region: 0x165, script: 0x57, flags: 0x0}, - 74: {region: 0x165, script: 0x57, flags: 0x0}, - 75: {region: 0x49, script: 0x57, flags: 0x0}, - 76: {region: 0x165, script: 0x57, flags: 0x0}, - 77: {region: 0x106, script: 0x1f, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x57, flags: 0x0}, - 80: {region: 0x165, script: 0x57, flags: 0x0}, - 81: {region: 0x165, script: 0x57, flags: 0x0}, - 82: {region: 0x99, script: 0x21, flags: 0x0}, - 83: {region: 0x165, script: 0x57, flags: 0x0}, - 84: {region: 0x165, script: 0x57, flags: 0x0}, - 85: {region: 0x165, script: 0x57, flags: 0x0}, - 86: {region: 0x3f, script: 0x57, flags: 0x0}, - 87: {region: 0x165, script: 0x57, flags: 0x0}, - 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x1f, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x57, flags: 0x0}, - 92: {region: 0xdb, script: 0x21, flags: 0x0}, - 93: {region: 0x2e, script: 0x57, flags: 0x0}, - 94: {region: 0x52, script: 0x57, flags: 0x0}, - 95: {region: 0x165, script: 0x57, flags: 0x0}, - 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x57, flags: 0x0}, - 98: {region: 0x165, script: 0x57, flags: 0x0}, - 99: {region: 0x95, script: 0x57, flags: 0x0}, - 100: {region: 0x165, script: 0x57, flags: 0x0}, - 101: {region: 0x52, script: 0x57, flags: 0x0}, - 102: {region: 0x165, script: 0x57, flags: 0x0}, - 103: {region: 0x165, script: 0x57, flags: 0x0}, - 104: {region: 0x165, script: 0x57, flags: 0x0}, - 105: {region: 0x165, script: 0x57, flags: 0x0}, - 106: {region: 0x4f, script: 0x57, flags: 0x0}, - 107: {region: 0x165, script: 0x57, flags: 0x0}, - 108: {region: 0x165, script: 0x57, flags: 0x0}, - 109: {region: 0x165, script: 0x57, flags: 0x0}, - 110: {region: 0x165, script: 0x29, flags: 0x0}, - 111: {region: 0x165, script: 0x57, flags: 0x0}, - 112: {region: 0x165, script: 0x57, flags: 0x0}, - 113: {region: 0x47, script: 0x1f, flags: 0x0}, - 114: {region: 0x165, script: 0x57, flags: 0x0}, - 115: {region: 0x165, script: 0x57, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x57, flags: 0x0}, - 118: {region: 0x165, script: 0x57, flags: 0x0}, - 119: {region: 0x95, script: 0x57, flags: 0x0}, - 120: {region: 0x165, script: 0x57, flags: 0x0}, - 121: {region: 0x12f, script: 0x57, flags: 0x0}, - 122: {region: 0x52, script: 0x57, flags: 0x0}, - 123: {region: 0x99, script: 0xd7, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x21, flags: 0x0}, - 126: {region: 0x38, script: 0x1f, flags: 0x0}, - 127: {region: 0x99, script: 0x21, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x31, flags: 0x0}, - 131: {region: 0x99, script: 0x21, flags: 0x0}, - 132: {region: 0x165, script: 0x57, flags: 0x0}, - 133: {region: 0x99, script: 0x21, flags: 0x0}, - 134: {region: 0xe7, script: 0x57, flags: 0x0}, - 135: {region: 0x165, script: 0x57, flags: 0x0}, - 136: {region: 0x99, script: 0x21, flags: 0x0}, - 137: {region: 0x165, script: 0x57, flags: 0x0}, - 138: {region: 0x13f, script: 0x57, flags: 0x0}, - 139: {region: 0x165, script: 0x57, flags: 0x0}, - 140: {region: 0x165, script: 0x57, flags: 0x0}, - 141: {region: 0xe7, script: 0x57, flags: 0x0}, - 142: {region: 0x165, script: 0x57, flags: 0x0}, - 143: {region: 0xd6, script: 0x57, flags: 0x0}, - 144: {region: 0x165, script: 0x57, flags: 0x0}, - 145: {region: 0x165, script: 0x57, flags: 0x0}, - 146: {region: 0x165, script: 0x57, flags: 0x0}, - 147: {region: 0x165, script: 0x29, flags: 0x0}, - 148: {region: 0x99, script: 0x21, flags: 0x0}, - 149: {region: 0x95, script: 0x57, flags: 0x0}, - 150: {region: 0x165, script: 0x57, flags: 0x0}, - 151: {region: 0x165, script: 0x57, flags: 0x0}, - 152: {region: 0x114, script: 0x57, flags: 0x0}, - 153: {region: 0x165, script: 0x57, flags: 0x0}, - 154: {region: 0x165, script: 0x57, flags: 0x0}, - 155: {region: 0x52, script: 0x57, flags: 0x0}, - 156: {region: 0x165, script: 0x57, flags: 0x0}, - 157: {region: 0xe7, script: 0x57, flags: 0x0}, - 158: {region: 0x165, script: 0x57, flags: 0x0}, - 159: {region: 0x13e, script: 0xd9, flags: 0x0}, - 160: {region: 0xc3, script: 0x57, flags: 0x0}, - 161: {region: 0x165, script: 0x57, flags: 0x0}, - 162: {region: 0x165, script: 0x57, flags: 0x0}, - 163: {region: 0xc3, script: 0x57, flags: 0x0}, - 164: {region: 0x165, script: 0x57, flags: 0x0}, - 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x57, flags: 0x0}, - 167: {region: 0x165, script: 0x57, flags: 0x0}, - 168: {region: 0x165, script: 0x57, flags: 0x0}, - 169: {region: 0x53, script: 0xe0, flags: 0x0}, - 170: {region: 0x165, script: 0x57, flags: 0x0}, - 171: {region: 0x165, script: 0x57, flags: 0x0}, - 172: {region: 0x165, script: 0x57, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x57, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x57, flags: 0x0}, - 177: {region: 0x4f, script: 0x57, flags: 0x0}, - 178: {region: 0x78, script: 0x57, flags: 0x0}, - 179: {region: 0x99, script: 0x21, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x21, flags: 0x0}, - 182: {region: 0x165, script: 0x57, flags: 0x0}, - 183: {region: 0x33, script: 0x57, flags: 0x0}, - 184: {region: 0x165, script: 0x57, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x57, flags: 0x0}, - 187: {region: 0x165, script: 0x29, flags: 0x0}, - 188: {region: 0xe7, script: 0x57, flags: 0x0}, - 189: {region: 0x165, script: 0x57, flags: 0x0}, - 190: {region: 0xe8, script: 0x21, flags: 0x0}, - 191: {region: 0x106, script: 0x1f, flags: 0x0}, - 192: {region: 0x15f, script: 0x57, flags: 0x0}, - 193: {region: 0x165, script: 0x57, flags: 0x0}, - 194: {region: 0x95, script: 0x57, flags: 0x0}, - 195: {region: 0x165, script: 0x57, flags: 0x0}, - 196: {region: 0x52, script: 0x57, flags: 0x0}, - 197: {region: 0x165, script: 0x57, flags: 0x0}, - 198: {region: 0x165, script: 0x57, flags: 0x0}, - 199: {region: 0x165, script: 0x57, flags: 0x0}, - 200: {region: 0x86, script: 0x57, flags: 0x0}, - 201: {region: 0x165, script: 0x57, flags: 0x0}, - 202: {region: 0x165, script: 0x57, flags: 0x0}, - 203: {region: 0x165, script: 0x57, flags: 0x0}, - 204: {region: 0x165, script: 0x57, flags: 0x0}, - 205: {region: 0x6d, script: 0x29, flags: 0x0}, - 206: {region: 0x165, script: 0x57, flags: 0x0}, - 207: {region: 0x165, script: 0x57, flags: 0x0}, - 208: {region: 0x52, script: 0x57, flags: 0x0}, - 209: {region: 0x165, script: 0x57, flags: 0x0}, - 210: {region: 0x165, script: 0x57, flags: 0x0}, - 211: {region: 0xc3, script: 0x57, flags: 0x0}, - 212: {region: 0x165, script: 0x57, flags: 0x0}, - 213: {region: 0x165, script: 0x57, flags: 0x0}, - 214: {region: 0x165, script: 0x57, flags: 0x0}, - 215: {region: 0x6e, script: 0x57, flags: 0x0}, - 216: {region: 0x165, script: 0x57, flags: 0x0}, - 217: {region: 0x165, script: 0x57, flags: 0x0}, - 218: {region: 0xd6, script: 0x57, flags: 0x0}, - 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x1f, flags: 0x0}, - 221: {region: 0xe7, script: 0x57, flags: 0x0}, - 222: {region: 0x165, script: 0x57, flags: 0x0}, - 223: {region: 0x131, script: 0x57, flags: 0x0}, - 224: {region: 0x8a, script: 0x57, flags: 0x0}, - 225: {region: 0x75, script: 0x57, flags: 0x0}, - 226: {region: 0x106, script: 0x1f, flags: 0x0}, - 227: {region: 0x135, script: 0x57, flags: 0x0}, - 228: {region: 0x49, script: 0x57, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x57, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x57, flags: 0x0}, - 235: {region: 0x165, script: 0x57, flags: 0x0}, - 236: {region: 0x165, script: 0x57, flags: 0x0}, - 237: {region: 0x165, script: 0x57, flags: 0x0}, - 238: {region: 0x165, script: 0x57, flags: 0x0}, - 239: {region: 0xc5, script: 0xcc, flags: 0x0}, - 240: {region: 0x78, script: 0x57, flags: 0x0}, - 241: {region: 0x6b, script: 0x1c, flags: 0x0}, - 242: {region: 0xe7, script: 0x57, flags: 0x0}, - 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x130, script: 0x1f, flags: 0x0}, - 245: {region: 0x49, script: 0x17, flags: 0x0}, - 246: {region: 0x49, script: 0x17, flags: 0x0}, - 247: {region: 0x49, script: 0x17, flags: 0x0}, - 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10a, script: 0x57, flags: 0x0}, - 250: {region: 0x5e, script: 0x57, flags: 0x0}, - 251: {region: 0xe9, script: 0x57, flags: 0x0}, - 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc4, script: 0x81, flags: 0x0}, - 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x106, script: 0x1f, flags: 0x0}, - 256: {region: 0x7b, script: 0x57, flags: 0x0}, - 257: {region: 0x63, script: 0x57, flags: 0x0}, - 258: {region: 0x165, script: 0x57, flags: 0x0}, - 259: {region: 0x165, script: 0x57, flags: 0x0}, - 260: {region: 0x165, script: 0x57, flags: 0x0}, - 261: {region: 0x165, script: 0x57, flags: 0x0}, - 262: {region: 0x135, script: 0x57, flags: 0x0}, - 263: {region: 0x106, script: 0x1f, flags: 0x0}, - 264: {region: 0xa4, script: 0x57, flags: 0x0}, - 265: {region: 0x165, script: 0x57, flags: 0x0}, - 266: {region: 0x165, script: 0x57, flags: 0x0}, - 267: {region: 0x99, script: 0x5, flags: 0x0}, - 268: {region: 0x165, script: 0x57, flags: 0x0}, - 269: {region: 0x60, script: 0x57, flags: 0x0}, - 270: {region: 0x165, script: 0x57, flags: 0x0}, - 271: {region: 0x49, script: 0x57, flags: 0x0}, - 272: {region: 0x165, script: 0x57, flags: 0x0}, - 273: {region: 0x165, script: 0x57, flags: 0x0}, - 274: {region: 0x165, script: 0x57, flags: 0x0}, - 275: {region: 0x165, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x57, flags: 0x0}, - 277: {region: 0x165, script: 0x57, flags: 0x0}, - 278: {region: 0x165, script: 0x57, flags: 0x0}, - 279: {region: 0xd4, script: 0x57, flags: 0x0}, - 280: {region: 0x4f, script: 0x57, flags: 0x0}, - 281: {region: 0x165, script: 0x57, flags: 0x0}, - 282: {region: 0x99, script: 0x5, flags: 0x0}, - 283: {region: 0x165, script: 0x57, flags: 0x0}, - 284: {region: 0x165, script: 0x57, flags: 0x0}, - 285: {region: 0x165, script: 0x57, flags: 0x0}, - 286: {region: 0x165, script: 0x29, flags: 0x0}, - 287: {region: 0x60, script: 0x57, flags: 0x0}, - 288: {region: 0xc3, script: 0x57, flags: 0x0}, - 289: {region: 0xd0, script: 0x57, flags: 0x0}, - 290: {region: 0x165, script: 0x57, flags: 0x0}, - 291: {region: 0xdb, script: 0x21, flags: 0x0}, - 292: {region: 0x52, script: 0x57, flags: 0x0}, - 293: {region: 0x165, script: 0x57, flags: 0x0}, - 294: {region: 0x165, script: 0x57, flags: 0x0}, - 295: {region: 0x165, script: 0x57, flags: 0x0}, - 296: {region: 0xcd, script: 0xde, flags: 0x0}, - 297: {region: 0x165, script: 0x57, flags: 0x0}, - 298: {region: 0x165, script: 0x57, flags: 0x0}, - 299: {region: 0x114, script: 0x57, flags: 0x0}, - 300: {region: 0x37, script: 0x57, flags: 0x0}, - 301: {region: 0x43, script: 0xe0, flags: 0x0}, - 302: {region: 0x165, script: 0x57, flags: 0x0}, - 303: {region: 0xa4, script: 0x57, flags: 0x0}, - 304: {region: 0x80, script: 0x57, flags: 0x0}, - 305: {region: 0xd6, script: 0x57, flags: 0x0}, - 306: {region: 0x9e, script: 0x57, flags: 0x0}, - 307: {region: 0x6b, script: 0x27, flags: 0x0}, - 308: {region: 0x165, script: 0x57, flags: 0x0}, - 309: {region: 0xc4, script: 0x48, flags: 0x0}, - 310: {region: 0x87, script: 0x31, flags: 0x0}, - 311: {region: 0x165, script: 0x57, flags: 0x0}, - 312: {region: 0x165, script: 0x57, flags: 0x0}, - 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x165, script: 0x57, flags: 0x0}, - 315: {region: 0x165, script: 0x57, flags: 0x0}, - 316: {region: 0x1, script: 0x57, flags: 0x0}, - 317: {region: 0x165, script: 0x57, flags: 0x0}, - 318: {region: 0x6e, script: 0x57, flags: 0x0}, - 319: {region: 0x135, script: 0x57, flags: 0x0}, - 320: {region: 0x6a, script: 0x57, flags: 0x0}, - 321: {region: 0x165, script: 0x57, flags: 0x0}, - 322: {region: 0x9e, script: 0x43, flags: 0x0}, - 323: {region: 0x165, script: 0x57, flags: 0x0}, - 324: {region: 0x165, script: 0x57, flags: 0x0}, - 325: {region: 0x6e, script: 0x57, flags: 0x0}, - 326: {region: 0x52, script: 0x57, flags: 0x0}, - 327: {region: 0x6e, script: 0x57, flags: 0x0}, - 328: {region: 0x9c, script: 0x5, flags: 0x0}, - 329: {region: 0x165, script: 0x57, flags: 0x0}, - 330: {region: 0x165, script: 0x57, flags: 0x0}, - 331: {region: 0x165, script: 0x57, flags: 0x0}, - 332: {region: 0x165, script: 0x57, flags: 0x0}, - 333: {region: 0x86, script: 0x57, flags: 0x0}, - 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x165, script: 0x57, flags: 0x0}, - 336: {region: 0xc3, script: 0x57, flags: 0x0}, - 337: {region: 0x72, script: 0x57, flags: 0x0}, - 338: {region: 0x10b, script: 0x5, flags: 0x0}, - 339: {region: 0xe7, script: 0x57, flags: 0x0}, - 340: {region: 0x10c, script: 0x57, flags: 0x0}, - 341: {region: 0x73, script: 0x57, flags: 0x0}, - 342: {region: 0x165, script: 0x57, flags: 0x0}, - 343: {region: 0x165, script: 0x57, flags: 0x0}, - 344: {region: 0x76, script: 0x57, flags: 0x0}, - 345: {region: 0x165, script: 0x57, flags: 0x0}, - 346: {region: 0x3b, script: 0x57, flags: 0x0}, - 347: {region: 0x165, script: 0x57, flags: 0x0}, - 348: {region: 0x165, script: 0x57, flags: 0x0}, - 349: {region: 0x165, script: 0x57, flags: 0x0}, - 350: {region: 0x78, script: 0x57, flags: 0x0}, - 351: {region: 0x135, script: 0x57, flags: 0x0}, - 352: {region: 0x78, script: 0x57, flags: 0x0}, - 353: {region: 0x60, script: 0x57, flags: 0x0}, - 354: {region: 0x60, script: 0x57, flags: 0x0}, - 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x140, script: 0x57, flags: 0x0}, - 357: {region: 0x165, script: 0x57, flags: 0x0}, - 358: {region: 0x84, script: 0x57, flags: 0x0}, - 359: {region: 0x165, script: 0x57, flags: 0x0}, - 360: {region: 0xd4, script: 0x57, flags: 0x0}, - 361: {region: 0x9e, script: 0x57, flags: 0x0}, - 362: {region: 0xd6, script: 0x57, flags: 0x0}, - 363: {region: 0x165, script: 0x57, flags: 0x0}, - 364: {region: 0x10b, script: 0x57, flags: 0x0}, - 365: {region: 0xd9, script: 0x57, flags: 0x0}, - 366: {region: 0x96, script: 0x57, flags: 0x0}, - 367: {region: 0x80, script: 0x57, flags: 0x0}, - 368: {region: 0x165, script: 0x57, flags: 0x0}, - 369: {region: 0xbc, script: 0x57, flags: 0x0}, - 370: {region: 0x165, script: 0x57, flags: 0x0}, - 371: {region: 0x165, script: 0x57, flags: 0x0}, - 372: {region: 0x165, script: 0x57, flags: 0x0}, - 373: {region: 0x53, script: 0x38, flags: 0x0}, - 374: {region: 0x165, script: 0x57, flags: 0x0}, - 375: {region: 0x95, script: 0x57, flags: 0x0}, - 376: {region: 0x165, script: 0x57, flags: 0x0}, - 377: {region: 0x165, script: 0x57, flags: 0x0}, - 378: {region: 0x99, script: 0x21, flags: 0x0}, - 379: {region: 0x165, script: 0x57, flags: 0x0}, - 380: {region: 0x9c, script: 0x5, flags: 0x0}, - 381: {region: 0x7e, script: 0x57, flags: 0x0}, - 382: {region: 0x7b, script: 0x57, flags: 0x0}, - 383: {region: 0x165, script: 0x57, flags: 0x0}, - 384: {region: 0x165, script: 0x57, flags: 0x0}, - 385: {region: 0x165, script: 0x57, flags: 0x0}, - 386: {region: 0x165, script: 0x57, flags: 0x0}, - 387: {region: 0x165, script: 0x57, flags: 0x0}, - 388: {region: 0x165, script: 0x57, flags: 0x0}, - 389: {region: 0x6f, script: 0x29, flags: 0x0}, - 390: {region: 0x165, script: 0x57, flags: 0x0}, - 391: {region: 0xdb, script: 0x21, flags: 0x0}, - 392: {region: 0x165, script: 0x57, flags: 0x0}, - 393: {region: 0xa7, script: 0x57, flags: 0x0}, - 394: {region: 0x165, script: 0x57, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x57, flags: 0x0}, - 397: {region: 0xe8, script: 0x5, flags: 0x0}, - 398: {region: 0x165, script: 0x57, flags: 0x0}, - 399: {region: 0x165, script: 0x57, flags: 0x0}, - 400: {region: 0x6e, script: 0x57, flags: 0x0}, - 401: {region: 0x9c, script: 0x5, flags: 0x0}, - 402: {region: 0x165, script: 0x57, flags: 0x0}, - 403: {region: 0x165, script: 0x29, flags: 0x0}, - 404: {region: 0xf1, script: 0x57, flags: 0x0}, - 405: {region: 0x165, script: 0x57, flags: 0x0}, - 406: {region: 0x165, script: 0x57, flags: 0x0}, - 407: {region: 0x165, script: 0x57, flags: 0x0}, - 408: {region: 0x165, script: 0x29, flags: 0x0}, - 409: {region: 0x165, script: 0x57, flags: 0x0}, - 410: {region: 0x99, script: 0x21, flags: 0x0}, - 411: {region: 0x99, script: 0xda, flags: 0x0}, - 412: {region: 0x95, script: 0x57, flags: 0x0}, - 413: {region: 0xd9, script: 0x57, flags: 0x0}, - 414: {region: 0x130, script: 0x2f, flags: 0x0}, - 415: {region: 0x165, script: 0x57, flags: 0x0}, - 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x99, script: 0xe, flags: 0x0}, - 418: {region: 0x165, script: 0x57, flags: 0x0}, - 419: {region: 0x4e, script: 0x57, flags: 0x0}, - 420: {region: 0x99, script: 0x32, flags: 0x0}, - 421: {region: 0x41, script: 0x57, flags: 0x0}, - 422: {region: 0x54, script: 0x57, flags: 0x0}, - 423: {region: 0x165, script: 0x57, flags: 0x0}, - 424: {region: 0x80, script: 0x57, flags: 0x0}, - 425: {region: 0x165, script: 0x57, flags: 0x0}, - 426: {region: 0x165, script: 0x57, flags: 0x0}, - 427: {region: 0xa4, script: 0x57, flags: 0x0}, - 428: {region: 0x98, script: 0x57, flags: 0x0}, - 429: {region: 0x165, script: 0x57, flags: 0x0}, - 430: {region: 0xdb, script: 0x21, flags: 0x0}, - 431: {region: 0x165, script: 0x57, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x57, flags: 0x0}, - 434: {region: 0x165, script: 0x5, flags: 0x0}, - 435: {region: 0x165, script: 0x57, flags: 0x0}, - 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x165, script: 0x57, flags: 0x0}, - 438: {region: 0x53, script: 0x38, flags: 0x0}, - 439: {region: 0x165, script: 0x57, flags: 0x0}, - 440: {region: 0x135, script: 0x57, flags: 0x0}, - 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x165, script: 0x57, flags: 0x0}, - 443: {region: 0x165, script: 0x29, flags: 0x0}, - 444: {region: 0x97, script: 0x3b, flags: 0x0}, - 445: {region: 0x165, script: 0x57, flags: 0x0}, - 446: {region: 0x99, script: 0x21, flags: 0x0}, - 447: {region: 0x165, script: 0x57, flags: 0x0}, - 448: {region: 0x73, script: 0x57, flags: 0x0}, - 449: {region: 0x165, script: 0x57, flags: 0x0}, - 450: {region: 0x165, script: 0x57, flags: 0x0}, - 451: {region: 0xe7, script: 0x57, flags: 0x0}, - 452: {region: 0x165, script: 0x57, flags: 0x0}, - 453: {region: 0x12b, script: 0x3d, flags: 0x0}, - 454: {region: 0x53, script: 0x89, flags: 0x0}, - 455: {region: 0x165, script: 0x57, flags: 0x0}, - 456: {region: 0xe8, script: 0x5, flags: 0x0}, - 457: {region: 0x99, script: 0x21, flags: 0x0}, - 458: {region: 0xaf, script: 0x3e, flags: 0x0}, - 459: {region: 0xe7, script: 0x57, flags: 0x0}, - 460: {region: 0xe8, script: 0x5, flags: 0x0}, - 461: {region: 0xe6, script: 0x57, flags: 0x0}, - 462: {region: 0x99, script: 0x21, flags: 0x0}, - 463: {region: 0x99, script: 0x21, flags: 0x0}, - 464: {region: 0x165, script: 0x57, flags: 0x0}, - 465: {region: 0x90, script: 0x57, flags: 0x0}, - 466: {region: 0x60, script: 0x57, flags: 0x0}, - 467: {region: 0x53, script: 0x38, flags: 0x0}, - 468: {region: 0x91, script: 0x57, flags: 0x0}, - 469: {region: 0x92, script: 0x57, flags: 0x0}, - 470: {region: 0x165, script: 0x57, flags: 0x0}, - 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd2, script: 0x57, flags: 0x0}, - 473: {region: 0x78, script: 0x57, flags: 0x0}, - 474: {region: 0x165, script: 0x57, flags: 0x0}, - 475: {region: 0x165, script: 0x57, flags: 0x0}, - 476: {region: 0xd0, script: 0x57, flags: 0x0}, - 477: {region: 0xd6, script: 0x57, flags: 0x0}, - 478: {region: 0x165, script: 0x57, flags: 0x0}, - 479: {region: 0x165, script: 0x57, flags: 0x0}, - 480: {region: 0x165, script: 0x57, flags: 0x0}, - 481: {region: 0x95, script: 0x57, flags: 0x0}, - 482: {region: 0x165, script: 0x57, flags: 0x0}, - 483: {region: 0x165, script: 0x57, flags: 0x0}, - 484: {region: 0x165, script: 0x57, flags: 0x0}, - 486: {region: 0x122, script: 0x57, flags: 0x0}, - 487: {region: 0xd6, script: 0x57, flags: 0x0}, - 488: {region: 0x165, script: 0x57, flags: 0x0}, - 489: {region: 0x165, script: 0x57, flags: 0x0}, - 490: {region: 0x53, script: 0xea, flags: 0x0}, - 491: {region: 0x165, script: 0x57, flags: 0x0}, - 492: {region: 0x135, script: 0x57, flags: 0x0}, - 493: {region: 0x165, script: 0x57, flags: 0x0}, - 494: {region: 0x49, script: 0x57, flags: 0x0}, - 495: {region: 0x165, script: 0x57, flags: 0x0}, - 496: {region: 0x165, script: 0x57, flags: 0x0}, - 497: {region: 0xe7, script: 0x57, flags: 0x0}, - 498: {region: 0x165, script: 0x57, flags: 0x0}, - 499: {region: 0x95, script: 0x57, flags: 0x0}, - 500: {region: 0x106, script: 0x1f, flags: 0x0}, - 501: {region: 0x1, script: 0x57, flags: 0x0}, - 502: {region: 0x165, script: 0x57, flags: 0x0}, - 503: {region: 0x165, script: 0x57, flags: 0x0}, - 504: {region: 0x9d, script: 0x57, flags: 0x0}, - 505: {region: 0x9e, script: 0x57, flags: 0x0}, - 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x97, script: 0x3b, flags: 0x0}, - 508: {region: 0x165, script: 0x57, flags: 0x0}, - 509: {region: 0x165, script: 0x57, flags: 0x0}, - 510: {region: 0x106, script: 0x57, flags: 0x0}, - 511: {region: 0x165, script: 0x57, flags: 0x0}, - 512: {region: 0xa2, script: 0x46, flags: 0x0}, - 513: {region: 0x165, script: 0x57, flags: 0x0}, - 514: {region: 0xa0, script: 0x57, flags: 0x0}, - 515: {region: 0x1, script: 0x57, flags: 0x0}, - 516: {region: 0x165, script: 0x57, flags: 0x0}, - 517: {region: 0x165, script: 0x57, flags: 0x0}, - 518: {region: 0x165, script: 0x57, flags: 0x0}, - 519: {region: 0x52, script: 0x57, flags: 0x0}, - 520: {region: 0x130, script: 0x3b, flags: 0x0}, - 521: {region: 0x165, script: 0x57, flags: 0x0}, - 522: {region: 0x12f, script: 0x57, flags: 0x0}, - 523: {region: 0xdb, script: 0x21, flags: 0x0}, - 524: {region: 0x165, script: 0x57, flags: 0x0}, - 525: {region: 0x63, script: 0x57, flags: 0x0}, - 526: {region: 0x95, script: 0x57, flags: 0x0}, - 527: {region: 0x95, script: 0x57, flags: 0x0}, - 528: {region: 0x7d, script: 0x2b, flags: 0x0}, - 529: {region: 0x137, script: 0x1f, flags: 0x0}, - 530: {region: 0x67, script: 0x57, flags: 0x0}, - 531: {region: 0xc4, script: 0x57, flags: 0x0}, - 532: {region: 0x165, script: 0x57, flags: 0x0}, - 533: {region: 0x165, script: 0x57, flags: 0x0}, - 534: {region: 0xd6, script: 0x57, flags: 0x0}, - 535: {region: 0xa4, script: 0x57, flags: 0x0}, - 536: {region: 0xc3, script: 0x57, flags: 0x0}, - 537: {region: 0x106, script: 0x1f, flags: 0x0}, - 538: {region: 0x165, script: 0x57, flags: 0x0}, - 539: {region: 0x165, script: 0x57, flags: 0x0}, - 540: {region: 0x165, script: 0x57, flags: 0x0}, - 541: {region: 0x165, script: 0x57, flags: 0x0}, - 542: {region: 0xd4, script: 0x5, flags: 0x0}, - 543: {region: 0xd6, script: 0x57, flags: 0x0}, - 544: {region: 0x164, script: 0x57, flags: 0x0}, - 545: {region: 0x165, script: 0x57, flags: 0x0}, - 546: {region: 0x165, script: 0x57, flags: 0x0}, - 547: {region: 0x12f, script: 0x57, flags: 0x0}, - 548: {region: 0x122, script: 0x5, flags: 0x0}, - 549: {region: 0x165, script: 0x57, flags: 0x0}, - 550: {region: 0x123, script: 0xdf, flags: 0x0}, - 551: {region: 0x5a, script: 0x57, flags: 0x0}, - 552: {region: 0x52, script: 0x57, flags: 0x0}, - 553: {region: 0x165, script: 0x57, flags: 0x0}, - 554: {region: 0x4f, script: 0x57, flags: 0x0}, - 555: {region: 0x99, script: 0x21, flags: 0x0}, - 556: {region: 0x99, script: 0x21, flags: 0x0}, - 557: {region: 0x4b, script: 0x57, flags: 0x0}, - 558: {region: 0x95, script: 0x57, flags: 0x0}, - 559: {region: 0x165, script: 0x57, flags: 0x0}, - 560: {region: 0x41, script: 0x57, flags: 0x0}, - 561: {region: 0x99, script: 0x57, flags: 0x0}, - 562: {region: 0x53, script: 0xd6, flags: 0x0}, - 563: {region: 0x99, script: 0x21, flags: 0x0}, - 564: {region: 0xc3, script: 0x57, flags: 0x0}, - 565: {region: 0x165, script: 0x57, flags: 0x0}, - 566: {region: 0x99, script: 0x72, flags: 0x0}, - 567: {region: 0xe8, script: 0x5, flags: 0x0}, - 568: {region: 0x165, script: 0x57, flags: 0x0}, - 569: {region: 0xa4, script: 0x57, flags: 0x0}, - 570: {region: 0x165, script: 0x57, flags: 0x0}, - 571: {region: 0x12b, script: 0x57, flags: 0x0}, - 572: {region: 0x165, script: 0x57, flags: 0x0}, - 573: {region: 0xd2, script: 0x57, flags: 0x0}, - 574: {region: 0x165, script: 0x57, flags: 0x0}, - 575: {region: 0xaf, script: 0x54, flags: 0x0}, - 576: {region: 0x165, script: 0x57, flags: 0x0}, - 577: {region: 0x165, script: 0x57, flags: 0x0}, - 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x165, script: 0x57, flags: 0x0}, - 580: {region: 0x52, script: 0x57, flags: 0x0}, - 581: {region: 0x82, script: 0x57, flags: 0x0}, - 582: {region: 0xa4, script: 0x57, flags: 0x0}, - 583: {region: 0x165, script: 0x57, flags: 0x0}, - 584: {region: 0x165, script: 0x57, flags: 0x0}, - 585: {region: 0x165, script: 0x57, flags: 0x0}, - 586: {region: 0xa6, script: 0x4b, flags: 0x0}, - 587: {region: 0x2a, script: 0x57, flags: 0x0}, - 588: {region: 0x165, script: 0x57, flags: 0x0}, - 589: {region: 0x165, script: 0x57, flags: 0x0}, - 590: {region: 0x165, script: 0x57, flags: 0x0}, - 591: {region: 0x165, script: 0x57, flags: 0x0}, - 592: {region: 0x165, script: 0x57, flags: 0x0}, - 593: {region: 0x99, script: 0x4f, flags: 0x0}, - 594: {region: 0x8b, script: 0x57, flags: 0x0}, - 595: {region: 0x165, script: 0x57, flags: 0x0}, - 596: {region: 0xab, script: 0x50, flags: 0x0}, - 597: {region: 0x106, script: 0x1f, flags: 0x0}, - 598: {region: 0x99, script: 0x21, flags: 0x0}, - 599: {region: 0x165, script: 0x57, flags: 0x0}, - 600: {region: 0x75, script: 0x57, flags: 0x0}, - 601: {region: 0x165, script: 0x57, flags: 0x0}, - 602: {region: 0xb4, script: 0x57, flags: 0x0}, - 603: {region: 0x165, script: 0x57, flags: 0x0}, - 604: {region: 0x165, script: 0x57, flags: 0x0}, - 605: {region: 0x165, script: 0x57, flags: 0x0}, - 606: {region: 0x165, script: 0x57, flags: 0x0}, - 607: {region: 0x165, script: 0x57, flags: 0x0}, - 608: {region: 0x165, script: 0x57, flags: 0x0}, - 609: {region: 0x165, script: 0x57, flags: 0x0}, - 610: {region: 0x165, script: 0x29, flags: 0x0}, - 611: {region: 0x165, script: 0x57, flags: 0x0}, - 612: {region: 0x106, script: 0x1f, flags: 0x0}, - 613: {region: 0x112, script: 0x57, flags: 0x0}, - 614: {region: 0xe7, script: 0x57, flags: 0x0}, - 615: {region: 0x106, script: 0x57, flags: 0x0}, - 616: {region: 0x165, script: 0x57, flags: 0x0}, - 617: {region: 0x99, script: 0x21, flags: 0x0}, - 618: {region: 0x99, script: 0x5, flags: 0x0}, - 619: {region: 0x12f, script: 0x57, flags: 0x0}, - 620: {region: 0x165, script: 0x57, flags: 0x0}, - 621: {region: 0x52, script: 0x57, flags: 0x0}, - 622: {region: 0x60, script: 0x57, flags: 0x0}, - 623: {region: 0x165, script: 0x57, flags: 0x0}, - 624: {region: 0x165, script: 0x57, flags: 0x0}, - 625: {region: 0x165, script: 0x29, flags: 0x0}, - 626: {region: 0x165, script: 0x57, flags: 0x0}, - 627: {region: 0x165, script: 0x57, flags: 0x0}, - 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x165, script: 0x57, flags: 0x0}, - 630: {region: 0x165, script: 0x57, flags: 0x0}, - 631: {region: 0x165, script: 0x57, flags: 0x0}, - 632: {region: 0x165, script: 0x57, flags: 0x0}, - 633: {region: 0x106, script: 0x1f, flags: 0x0}, - 634: {region: 0x165, script: 0x57, flags: 0x0}, - 635: {region: 0x165, script: 0x57, flags: 0x0}, - 636: {region: 0x165, script: 0x57, flags: 0x0}, - 637: {region: 0x106, script: 0x1f, flags: 0x0}, - 638: {region: 0x165, script: 0x57, flags: 0x0}, - 639: {region: 0x95, script: 0x57, flags: 0x0}, - 640: {region: 0xe8, script: 0x5, flags: 0x0}, - 641: {region: 0x7b, script: 0x57, flags: 0x0}, - 642: {region: 0x165, script: 0x57, flags: 0x0}, - 643: {region: 0x165, script: 0x57, flags: 0x0}, - 644: {region: 0x165, script: 0x57, flags: 0x0}, - 645: {region: 0x165, script: 0x29, flags: 0x0}, - 646: {region: 0x123, script: 0xdf, flags: 0x0}, - 647: {region: 0xe8, script: 0x5, flags: 0x0}, - 648: {region: 0x165, script: 0x57, flags: 0x0}, - 649: {region: 0x165, script: 0x57, flags: 0x0}, - 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x165, script: 0x57, flags: 0x0}, - 652: {region: 0x165, script: 0x57, flags: 0x0}, - 653: {region: 0x165, script: 0x57, flags: 0x0}, - 654: {region: 0x138, script: 0x57, flags: 0x0}, - 655: {region: 0x87, script: 0x5b, flags: 0x0}, - 656: {region: 0x97, script: 0x3b, flags: 0x0}, - 657: {region: 0x12f, script: 0x57, flags: 0x0}, - 658: {region: 0xe8, script: 0x5, flags: 0x0}, - 659: {region: 0x131, script: 0x57, flags: 0x0}, - 660: {region: 0x165, script: 0x57, flags: 0x0}, - 661: {region: 0xb7, script: 0x57, flags: 0x0}, - 662: {region: 0x106, script: 0x1f, flags: 0x0}, - 663: {region: 0x165, script: 0x57, flags: 0x0}, - 664: {region: 0x95, script: 0x57, flags: 0x0}, - 665: {region: 0x165, script: 0x57, flags: 0x0}, - 666: {region: 0x53, script: 0xdf, flags: 0x0}, - 667: {region: 0x165, script: 0x57, flags: 0x0}, - 668: {region: 0x165, script: 0x57, flags: 0x0}, - 669: {region: 0x165, script: 0x57, flags: 0x0}, - 670: {region: 0x165, script: 0x57, flags: 0x0}, - 671: {region: 0x99, script: 0x59, flags: 0x0}, - 672: {region: 0x165, script: 0x57, flags: 0x0}, - 673: {region: 0x165, script: 0x57, flags: 0x0}, - 674: {region: 0x106, script: 0x1f, flags: 0x0}, - 675: {region: 0x131, script: 0x57, flags: 0x0}, - 676: {region: 0x165, script: 0x57, flags: 0x0}, - 677: {region: 0xd9, script: 0x57, flags: 0x0}, - 678: {region: 0x165, script: 0x57, flags: 0x0}, - 679: {region: 0x165, script: 0x57, flags: 0x0}, - 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x165, script: 0x57, flags: 0x0}, - 682: {region: 0x165, script: 0x57, flags: 0x0}, - 683: {region: 0x9e, script: 0x57, flags: 0x0}, - 684: {region: 0x53, script: 0x5d, flags: 0x0}, - 685: {region: 0x95, script: 0x57, flags: 0x0}, - 686: {region: 0x9c, script: 0x5, flags: 0x0}, - 687: {region: 0x135, script: 0x57, flags: 0x0}, - 688: {region: 0x165, script: 0x57, flags: 0x0}, - 689: {region: 0x165, script: 0x57, flags: 0x0}, - 690: {region: 0x99, script: 0xda, flags: 0x0}, - 691: {region: 0x9e, script: 0x57, flags: 0x0}, - 692: {region: 0x165, script: 0x57, flags: 0x0}, - 693: {region: 0x4b, script: 0x57, flags: 0x0}, - 694: {region: 0x165, script: 0x57, flags: 0x0}, - 695: {region: 0x165, script: 0x57, flags: 0x0}, - 696: {region: 0xaf, script: 0x54, flags: 0x0}, - 697: {region: 0x165, script: 0x57, flags: 0x0}, - 698: {region: 0x165, script: 0x57, flags: 0x0}, - 699: {region: 0x4b, script: 0x57, flags: 0x0}, - 700: {region: 0x165, script: 0x57, flags: 0x0}, - 701: {region: 0x165, script: 0x57, flags: 0x0}, - 702: {region: 0x162, script: 0x57, flags: 0x0}, - 703: {region: 0x9c, script: 0x5, flags: 0x0}, - 704: {region: 0xb6, script: 0x57, flags: 0x0}, - 705: {region: 0xb8, script: 0x57, flags: 0x0}, - 706: {region: 0x4b, script: 0x57, flags: 0x0}, - 707: {region: 0x4b, script: 0x57, flags: 0x0}, - 708: {region: 0xa4, script: 0x57, flags: 0x0}, - 709: {region: 0xa4, script: 0x57, flags: 0x0}, - 710: {region: 0x9c, script: 0x5, flags: 0x0}, - 711: {region: 0xb8, script: 0x57, flags: 0x0}, - 712: {region: 0x123, script: 0xdf, flags: 0x0}, - 713: {region: 0x53, script: 0x38, flags: 0x0}, - 714: {region: 0x12b, script: 0x57, flags: 0x0}, - 715: {region: 0x95, script: 0x57, flags: 0x0}, - 716: {region: 0x52, script: 0x57, flags: 0x0}, - 717: {region: 0x99, script: 0x21, flags: 0x0}, - 718: {region: 0x99, script: 0x21, flags: 0x0}, - 719: {region: 0x95, script: 0x57, flags: 0x0}, - 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa4, script: 0x57, flags: 0x0}, - 722: {region: 0x165, script: 0x57, flags: 0x0}, - 723: {region: 0xcf, script: 0x57, flags: 0x0}, - 724: {region: 0x165, script: 0x57, flags: 0x0}, - 725: {region: 0x165, script: 0x57, flags: 0x0}, - 726: {region: 0x165, script: 0x57, flags: 0x0}, - 727: {region: 0x165, script: 0x57, flags: 0x0}, - 728: {region: 0x165, script: 0x57, flags: 0x0}, - 729: {region: 0x165, script: 0x57, flags: 0x0}, - 730: {region: 0x165, script: 0x57, flags: 0x0}, - 731: {region: 0x165, script: 0x57, flags: 0x0}, - 732: {region: 0x165, script: 0x57, flags: 0x0}, - 733: {region: 0x165, script: 0x57, flags: 0x0}, - 734: {region: 0x165, script: 0x57, flags: 0x0}, - 735: {region: 0x165, script: 0x5, flags: 0x0}, - 736: {region: 0x106, script: 0x1f, flags: 0x0}, - 737: {region: 0xe7, script: 0x57, flags: 0x0}, - 738: {region: 0x165, script: 0x57, flags: 0x0}, - 739: {region: 0x95, script: 0x57, flags: 0x0}, - 740: {region: 0x165, script: 0x29, flags: 0x0}, - 741: {region: 0x165, script: 0x57, flags: 0x0}, - 742: {region: 0x165, script: 0x57, flags: 0x0}, - 743: {region: 0x165, script: 0x57, flags: 0x0}, - 744: {region: 0x112, script: 0x57, flags: 0x0}, - 745: {region: 0xa4, script: 0x57, flags: 0x0}, - 746: {region: 0x165, script: 0x57, flags: 0x0}, - 747: {region: 0x165, script: 0x57, flags: 0x0}, - 748: {region: 0x123, script: 0x5, flags: 0x0}, - 749: {region: 0xcc, script: 0x57, flags: 0x0}, - 750: {region: 0x165, script: 0x57, flags: 0x0}, - 751: {region: 0x165, script: 0x57, flags: 0x0}, - 752: {region: 0x165, script: 0x57, flags: 0x0}, - 753: {region: 0xbf, script: 0x57, flags: 0x0}, - 754: {region: 0xd1, script: 0x57, flags: 0x0}, - 755: {region: 0x165, script: 0x57, flags: 0x0}, - 756: {region: 0x52, script: 0x57, flags: 0x0}, - 757: {region: 0xdb, script: 0x21, flags: 0x0}, - 758: {region: 0x12f, script: 0x57, flags: 0x0}, - 759: {region: 0xc0, script: 0x57, flags: 0x0}, - 760: {region: 0x165, script: 0x57, flags: 0x0}, - 761: {region: 0x165, script: 0x57, flags: 0x0}, - 762: {region: 0xe0, script: 0x57, flags: 0x0}, - 763: {region: 0x165, script: 0x57, flags: 0x0}, - 764: {region: 0x95, script: 0x57, flags: 0x0}, - 765: {region: 0x9b, script: 0x3a, flags: 0x0}, - 766: {region: 0x165, script: 0x57, flags: 0x0}, - 767: {region: 0xc2, script: 0x1f, flags: 0x0}, - 768: {region: 0x165, script: 0x5, flags: 0x0}, - 769: {region: 0x165, script: 0x57, flags: 0x0}, - 770: {region: 0x165, script: 0x57, flags: 0x0}, - 771: {region: 0x165, script: 0x57, flags: 0x0}, - 772: {region: 0x99, script: 0x6b, flags: 0x0}, - 773: {region: 0x165, script: 0x57, flags: 0x0}, - 774: {region: 0x165, script: 0x57, flags: 0x0}, - 775: {region: 0x10b, script: 0x57, flags: 0x0}, - 776: {region: 0x165, script: 0x57, flags: 0x0}, - 777: {region: 0x165, script: 0x57, flags: 0x0}, - 778: {region: 0x165, script: 0x57, flags: 0x0}, - 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x165, script: 0x57, flags: 0x0}, - 781: {region: 0x165, script: 0x57, flags: 0x0}, - 782: {region: 0x99, script: 0xe, flags: 0x0}, - 783: {region: 0xc4, script: 0x72, flags: 0x0}, - 785: {region: 0x165, script: 0x57, flags: 0x0}, - 786: {region: 0x49, script: 0x57, flags: 0x0}, - 787: {region: 0x49, script: 0x57, flags: 0x0}, - 788: {region: 0x37, script: 0x57, flags: 0x0}, - 789: {region: 0x165, script: 0x57, flags: 0x0}, - 790: {region: 0x165, script: 0x57, flags: 0x0}, - 791: {region: 0x165, script: 0x57, flags: 0x0}, - 792: {region: 0x165, script: 0x57, flags: 0x0}, - 793: {region: 0x165, script: 0x57, flags: 0x0}, - 794: {region: 0x165, script: 0x57, flags: 0x0}, - 795: {region: 0x99, script: 0x21, flags: 0x0}, - 796: {region: 0xdb, script: 0x21, flags: 0x0}, - 797: {region: 0x106, script: 0x1f, flags: 0x0}, - 798: {region: 0x35, script: 0x6f, flags: 0x0}, - 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcb, script: 0x57, flags: 0x0}, - 801: {region: 0x165, script: 0x57, flags: 0x0}, - 802: {region: 0x165, script: 0x57, flags: 0x0}, - 803: {region: 0x165, script: 0x57, flags: 0x0}, - 804: {region: 0x99, script: 0x21, flags: 0x0}, - 805: {region: 0x52, script: 0x57, flags: 0x0}, - 807: {region: 0x165, script: 0x57, flags: 0x0}, - 808: {region: 0x135, script: 0x57, flags: 0x0}, - 809: {region: 0x165, script: 0x57, flags: 0x0}, - 810: {region: 0x165, script: 0x57, flags: 0x0}, - 811: {region: 0xe8, script: 0x5, flags: 0x0}, - 812: {region: 0xc3, script: 0x57, flags: 0x0}, - 813: {region: 0x99, script: 0x21, flags: 0x0}, - 814: {region: 0x95, script: 0x57, flags: 0x0}, - 815: {region: 0x164, script: 0x57, flags: 0x0}, - 816: {region: 0x165, script: 0x57, flags: 0x0}, - 817: {region: 0xc4, script: 0x72, flags: 0x0}, - 818: {region: 0x165, script: 0x57, flags: 0x0}, - 819: {region: 0x165, script: 0x29, flags: 0x0}, - 820: {region: 0x106, script: 0x1f, flags: 0x0}, - 821: {region: 0x165, script: 0x57, flags: 0x0}, - 822: {region: 0x131, script: 0x57, flags: 0x0}, - 823: {region: 0x9c, script: 0x63, flags: 0x0}, - 824: {region: 0x165, script: 0x57, flags: 0x0}, - 825: {region: 0x165, script: 0x57, flags: 0x0}, - 826: {region: 0x9c, script: 0x5, flags: 0x0}, - 827: {region: 0x165, script: 0x57, flags: 0x0}, - 828: {region: 0x165, script: 0x57, flags: 0x0}, - 829: {region: 0x165, script: 0x57, flags: 0x0}, - 830: {region: 0xdd, script: 0x57, flags: 0x0}, - 831: {region: 0x165, script: 0x57, flags: 0x0}, - 832: {region: 0x165, script: 0x57, flags: 0x0}, - 834: {region: 0x165, script: 0x57, flags: 0x0}, - 835: {region: 0x53, script: 0x38, flags: 0x0}, - 836: {region: 0x9e, script: 0x57, flags: 0x0}, - 837: {region: 0xd2, script: 0x57, flags: 0x0}, - 838: {region: 0x165, script: 0x57, flags: 0x0}, - 839: {region: 0xda, script: 0x57, flags: 0x0}, - 840: {region: 0x165, script: 0x57, flags: 0x0}, - 841: {region: 0x165, script: 0x57, flags: 0x0}, - 842: {region: 0x165, script: 0x57, flags: 0x0}, - 843: {region: 0xcf, script: 0x57, flags: 0x0}, - 844: {region: 0x165, script: 0x57, flags: 0x0}, - 845: {region: 0x165, script: 0x57, flags: 0x0}, - 846: {region: 0x164, script: 0x57, flags: 0x0}, - 847: {region: 0xd1, script: 0x57, flags: 0x0}, - 848: {region: 0x60, script: 0x57, flags: 0x0}, - 849: {region: 0xdb, script: 0x21, flags: 0x0}, - 850: {region: 0x165, script: 0x57, flags: 0x0}, - 851: {region: 0xdb, script: 0x21, flags: 0x0}, - 852: {region: 0x165, script: 0x57, flags: 0x0}, - 853: {region: 0x165, script: 0x57, flags: 0x0}, - 854: {region: 0xd2, script: 0x57, flags: 0x0}, - 855: {region: 0x165, script: 0x57, flags: 0x0}, - 856: {region: 0x165, script: 0x57, flags: 0x0}, - 857: {region: 0xd1, script: 0x57, flags: 0x0}, - 858: {region: 0x165, script: 0x57, flags: 0x0}, - 859: {region: 0xcf, script: 0x57, flags: 0x0}, - 860: {region: 0xcf, script: 0x57, flags: 0x0}, - 861: {region: 0x165, script: 0x57, flags: 0x0}, - 862: {region: 0x165, script: 0x57, flags: 0x0}, - 863: {region: 0x95, script: 0x57, flags: 0x0}, - 864: {region: 0x165, script: 0x57, flags: 0x0}, - 865: {region: 0xdf, script: 0x57, flags: 0x0}, - 866: {region: 0x165, script: 0x57, flags: 0x0}, - 867: {region: 0x165, script: 0x57, flags: 0x0}, - 868: {region: 0x99, script: 0x57, flags: 0x0}, - 869: {region: 0x165, script: 0x57, flags: 0x0}, - 870: {region: 0x165, script: 0x57, flags: 0x0}, - 871: {region: 0xd9, script: 0x57, flags: 0x0}, - 872: {region: 0x52, script: 0x57, flags: 0x0}, - 873: {region: 0x165, script: 0x57, flags: 0x0}, - 874: {region: 0xda, script: 0x57, flags: 0x0}, - 875: {region: 0x165, script: 0x57, flags: 0x0}, - 876: {region: 0x52, script: 0x57, flags: 0x0}, - 877: {region: 0x165, script: 0x57, flags: 0x0}, - 878: {region: 0x165, script: 0x57, flags: 0x0}, - 879: {region: 0xda, script: 0x57, flags: 0x0}, - 880: {region: 0x123, script: 0x53, flags: 0x0}, - 881: {region: 0x99, script: 0x21, flags: 0x0}, - 882: {region: 0x10c, script: 0xbf, flags: 0x0}, - 883: {region: 0x165, script: 0x57, flags: 0x0}, - 884: {region: 0x165, script: 0x57, flags: 0x0}, - 885: {region: 0x84, script: 0x78, flags: 0x0}, - 886: {region: 0x161, script: 0x57, flags: 0x0}, - 887: {region: 0x165, script: 0x57, flags: 0x0}, - 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x165, script: 0x57, flags: 0x0}, - 890: {region: 0x161, script: 0x57, flags: 0x0}, - 891: {region: 0x165, script: 0x57, flags: 0x0}, - 892: {region: 0x165, script: 0x57, flags: 0x0}, - 893: {region: 0x165, script: 0x57, flags: 0x0}, - 894: {region: 0x165, script: 0x57, flags: 0x0}, - 895: {region: 0x165, script: 0x57, flags: 0x0}, - 896: {region: 0x117, script: 0x57, flags: 0x0}, - 897: {region: 0x165, script: 0x57, flags: 0x0}, - 898: {region: 0x165, script: 0x57, flags: 0x0}, - 899: {region: 0x135, script: 0x57, flags: 0x0}, - 900: {region: 0x165, script: 0x57, flags: 0x0}, - 901: {region: 0x53, script: 0x57, flags: 0x0}, - 902: {region: 0x165, script: 0x57, flags: 0x0}, - 903: {region: 0xce, script: 0x57, flags: 0x0}, - 904: {region: 0x12f, script: 0x57, flags: 0x0}, - 905: {region: 0x131, script: 0x57, flags: 0x0}, - 906: {region: 0x80, script: 0x57, flags: 0x0}, - 907: {region: 0x78, script: 0x57, flags: 0x0}, - 908: {region: 0x165, script: 0x57, flags: 0x0}, - 910: {region: 0x165, script: 0x57, flags: 0x0}, - 911: {region: 0x165, script: 0x57, flags: 0x0}, - 912: {region: 0x6f, script: 0x57, flags: 0x0}, - 913: {region: 0x165, script: 0x57, flags: 0x0}, - 914: {region: 0x165, script: 0x57, flags: 0x0}, - 915: {region: 0x165, script: 0x57, flags: 0x0}, - 916: {region: 0x165, script: 0x57, flags: 0x0}, - 917: {region: 0x99, script: 0x7d, flags: 0x0}, - 918: {region: 0x165, script: 0x57, flags: 0x0}, - 919: {region: 0x165, script: 0x5, flags: 0x0}, - 920: {region: 0x7d, script: 0x1f, flags: 0x0}, - 921: {region: 0x135, script: 0x7e, flags: 0x0}, - 922: {region: 0x165, script: 0x5, flags: 0x0}, - 923: {region: 0xc5, script: 0x7c, flags: 0x0}, - 924: {region: 0x165, script: 0x57, flags: 0x0}, - 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe7, script: 0x57, flags: 0x0}, - 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe7, script: 0x57, flags: 0x0}, - 929: {region: 0x30, script: 0x57, flags: 0x0}, - 930: {region: 0xf0, script: 0x57, flags: 0x0}, - 931: {region: 0x165, script: 0x57, flags: 0x0}, - 932: {region: 0x78, script: 0x57, flags: 0x0}, - 933: {region: 0xd6, script: 0x57, flags: 0x0}, - 934: {region: 0x135, script: 0x57, flags: 0x0}, - 935: {region: 0x49, script: 0x57, flags: 0x0}, - 936: {region: 0x165, script: 0x57, flags: 0x0}, - 937: {region: 0x9c, script: 0xe8, flags: 0x0}, - 938: {region: 0x165, script: 0x57, flags: 0x0}, - 939: {region: 0x60, script: 0x57, flags: 0x0}, - 940: {region: 0x165, script: 0x5, flags: 0x0}, - 941: {region: 0xb0, script: 0x87, flags: 0x0}, - 943: {region: 0x165, script: 0x57, flags: 0x0}, - 944: {region: 0x165, script: 0x57, flags: 0x0}, - 945: {region: 0x99, script: 0x12, flags: 0x0}, - 946: {region: 0xa4, script: 0x57, flags: 0x0}, - 947: {region: 0xe9, script: 0x57, flags: 0x0}, - 948: {region: 0x165, script: 0x57, flags: 0x0}, - 949: {region: 0x9e, script: 0x57, flags: 0x0}, - 950: {region: 0x165, script: 0x57, flags: 0x0}, - 951: {region: 0x165, script: 0x57, flags: 0x0}, - 952: {region: 0x87, script: 0x31, flags: 0x0}, - 953: {region: 0x75, script: 0x57, flags: 0x0}, - 954: {region: 0x165, script: 0x57, flags: 0x0}, - 955: {region: 0xe8, script: 0x4a, flags: 0x0}, - 956: {region: 0x9c, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x57, flags: 0x0}, - 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x165, script: 0x57, flags: 0x0}, - 960: {region: 0x41, script: 0x57, flags: 0x0}, - 961: {region: 0x165, script: 0x57, flags: 0x0}, - 962: {region: 0x7a, script: 0x57, flags: 0x0}, - 963: {region: 0x165, script: 0x57, flags: 0x0}, - 964: {region: 0xe4, script: 0x57, flags: 0x0}, - 965: {region: 0x89, script: 0x57, flags: 0x0}, - 966: {region: 0x69, script: 0x57, flags: 0x0}, - 967: {region: 0x165, script: 0x57, flags: 0x0}, - 968: {region: 0x99, script: 0x21, flags: 0x0}, - 969: {region: 0x165, script: 0x57, flags: 0x0}, - 970: {region: 0x102, script: 0x57, flags: 0x0}, - 971: {region: 0x95, script: 0x57, flags: 0x0}, - 972: {region: 0x165, script: 0x57, flags: 0x0}, - 973: {region: 0x165, script: 0x57, flags: 0x0}, - 974: {region: 0x9e, script: 0x57, flags: 0x0}, - 975: {region: 0x165, script: 0x5, flags: 0x0}, - 976: {region: 0x99, script: 0x57, flags: 0x0}, - 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdb, script: 0x21, flags: 0x0}, - 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x57, flags: 0x0}, - 981: {region: 0x72, script: 0x57, flags: 0x0}, - 982: {region: 0x4e, script: 0x57, flags: 0x0}, - 983: {region: 0x9c, script: 0x5, flags: 0x0}, - 984: {region: 0x10c, script: 0x57, flags: 0x0}, - 985: {region: 0x3a, script: 0x57, flags: 0x0}, - 986: {region: 0x165, script: 0x57, flags: 0x0}, - 987: {region: 0xd1, script: 0x57, flags: 0x0}, - 988: {region: 0x104, script: 0x57, flags: 0x0}, - 989: {region: 0x95, script: 0x57, flags: 0x0}, - 990: {region: 0x12f, script: 0x57, flags: 0x0}, - 991: {region: 0x165, script: 0x57, flags: 0x0}, - 992: {region: 0x165, script: 0x57, flags: 0x0}, - 993: {region: 0x73, script: 0x57, flags: 0x0}, - 994: {region: 0x106, script: 0x1f, flags: 0x0}, - 995: {region: 0x130, script: 0x1f, flags: 0x0}, - 996: {region: 0x109, script: 0x57, flags: 0x0}, - 997: {region: 0x107, script: 0x57, flags: 0x0}, - 998: {region: 0x12f, script: 0x57, flags: 0x0}, - 999: {region: 0x165, script: 0x57, flags: 0x0}, - 1000: {region: 0xa2, script: 0x49, flags: 0x0}, - 1001: {region: 0x99, script: 0x21, flags: 0x0}, - 1002: {region: 0x80, script: 0x57, flags: 0x0}, - 1003: {region: 0x106, script: 0x1f, flags: 0x0}, - 1004: {region: 0xa4, script: 0x57, flags: 0x0}, - 1005: {region: 0x95, script: 0x57, flags: 0x0}, - 1006: {region: 0x99, script: 0x57, flags: 0x0}, - 1007: {region: 0x114, script: 0x57, flags: 0x0}, - 1008: {region: 0x99, script: 0xc3, flags: 0x0}, - 1009: {region: 0x165, script: 0x57, flags: 0x0}, - 1010: {region: 0x165, script: 0x57, flags: 0x0}, - 1011: {region: 0x12f, script: 0x57, flags: 0x0}, - 1012: {region: 0x9e, script: 0x57, flags: 0x0}, - 1013: {region: 0x99, script: 0x21, flags: 0x0}, - 1014: {region: 0x165, script: 0x5, flags: 0x0}, - 1015: {region: 0x9e, script: 0x57, flags: 0x0}, - 1016: {region: 0x7b, script: 0x57, flags: 0x0}, - 1017: {region: 0x49, script: 0x57, flags: 0x0}, - 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9e, script: 0x57, flags: 0x0}, - 1020: {region: 0x9c, script: 0x5, flags: 0x0}, - 1021: {region: 0xda, script: 0x57, flags: 0x0}, - 1022: {region: 0x4f, script: 0x57, flags: 0x0}, - 1023: {region: 0xd1, script: 0x57, flags: 0x0}, - 1024: {region: 0xcf, script: 0x57, flags: 0x0}, - 1025: {region: 0xc3, script: 0x57, flags: 0x0}, - 1026: {region: 0x4c, script: 0x57, flags: 0x0}, - 1027: {region: 0x96, script: 0x7a, flags: 0x0}, - 1028: {region: 0xb6, script: 0x57, flags: 0x0}, - 1029: {region: 0x165, script: 0x29, flags: 0x0}, - 1030: {region: 0x165, script: 0x57, flags: 0x0}, - 1032: {region: 0xba, script: 0xdc, flags: 0x0}, - 1033: {region: 0x165, script: 0x57, flags: 0x0}, - 1034: {region: 0xc4, script: 0x72, flags: 0x0}, - 1035: {region: 0x165, script: 0x5, flags: 0x0}, - 1036: {region: 0xb3, script: 0xca, flags: 0x0}, - 1037: {region: 0x6f, script: 0x57, flags: 0x0}, - 1038: {region: 0x165, script: 0x57, flags: 0x0}, - 1039: {region: 0x165, script: 0x57, flags: 0x0}, - 1040: {region: 0x165, script: 0x57, flags: 0x0}, - 1041: {region: 0x165, script: 0x57, flags: 0x0}, - 1042: {region: 0x111, script: 0x57, flags: 0x0}, - 1043: {region: 0x165, script: 0x57, flags: 0x0}, - 1044: {region: 0xe8, script: 0x5, flags: 0x0}, - 1045: {region: 0x165, script: 0x57, flags: 0x0}, - 1046: {region: 0x10f, script: 0x57, flags: 0x0}, - 1047: {region: 0x165, script: 0x57, flags: 0x0}, - 1048: {region: 0xe9, script: 0x57, flags: 0x0}, - 1049: {region: 0x165, script: 0x57, flags: 0x0}, - 1050: {region: 0x95, script: 0x57, flags: 0x0}, - 1051: {region: 0x142, script: 0x57, flags: 0x0}, - 1052: {region: 0x10c, script: 0x57, flags: 0x0}, - 1054: {region: 0x10c, script: 0x57, flags: 0x0}, - 1055: {region: 0x72, script: 0x57, flags: 0x0}, - 1056: {region: 0x97, script: 0xc0, flags: 0x0}, - 1057: {region: 0x165, script: 0x57, flags: 0x0}, - 1058: {region: 0x72, script: 0x57, flags: 0x0}, - 1059: {region: 0x164, script: 0x57, flags: 0x0}, - 1060: {region: 0x165, script: 0x57, flags: 0x0}, - 1061: {region: 0xc3, script: 0x57, flags: 0x0}, - 1062: {region: 0x165, script: 0x57, flags: 0x0}, - 1063: {region: 0x165, script: 0x57, flags: 0x0}, - 1064: {region: 0x165, script: 0x57, flags: 0x0}, - 1065: {region: 0x115, script: 0x57, flags: 0x0}, - 1066: {region: 0x165, script: 0x57, flags: 0x0}, - 1067: {region: 0x165, script: 0x57, flags: 0x0}, - 1068: {region: 0x123, script: 0xdf, flags: 0x0}, - 1069: {region: 0x165, script: 0x57, flags: 0x0}, - 1070: {region: 0x165, script: 0x57, flags: 0x0}, - 1071: {region: 0x165, script: 0x57, flags: 0x0}, - 1072: {region: 0x165, script: 0x57, flags: 0x0}, - 1073: {region: 0x27, script: 0x57, flags: 0x0}, - 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x99, script: 0xcb, flags: 0x0}, - 1076: {region: 0x116, script: 0x57, flags: 0x0}, - 1077: {region: 0x114, script: 0x57, flags: 0x0}, - 1078: {region: 0x99, script: 0x21, flags: 0x0}, - 1079: {region: 0x161, script: 0x57, flags: 0x0}, - 1080: {region: 0x165, script: 0x57, flags: 0x0}, - 1081: {region: 0x165, script: 0x57, flags: 0x0}, - 1082: {region: 0x6d, script: 0x57, flags: 0x0}, - 1083: {region: 0x161, script: 0x57, flags: 0x0}, - 1084: {region: 0x165, script: 0x57, flags: 0x0}, - 1085: {region: 0x60, script: 0x57, flags: 0x0}, - 1086: {region: 0x95, script: 0x57, flags: 0x0}, - 1087: {region: 0x165, script: 0x57, flags: 0x0}, - 1088: {region: 0x165, script: 0x57, flags: 0x0}, - 1089: {region: 0x12f, script: 0x57, flags: 0x0}, - 1090: {region: 0x165, script: 0x57, flags: 0x0}, - 1091: {region: 0x84, script: 0x57, flags: 0x0}, - 1092: {region: 0x10c, script: 0x57, flags: 0x0}, - 1093: {region: 0x12f, script: 0x57, flags: 0x0}, - 1094: {region: 0x15f, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x57, flags: 0x0}, - 1096: {region: 0x60, script: 0x57, flags: 0x0}, - 1097: {region: 0x165, script: 0x57, flags: 0x0}, - 1098: {region: 0x99, script: 0x21, flags: 0x0}, - 1099: {region: 0x95, script: 0x57, flags: 0x0}, - 1100: {region: 0x165, script: 0x57, flags: 0x0}, - 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9b, script: 0xcf, flags: 0x0}, - 1103: {region: 0xe9, script: 0x57, flags: 0x0}, - 1104: {region: 0x99, script: 0xd7, flags: 0x0}, - 1105: {region: 0xdb, script: 0x21, flags: 0x0}, - 1106: {region: 0x165, script: 0x57, flags: 0x0}, - 1107: {region: 0x165, script: 0x57, flags: 0x0}, - 1108: {region: 0x165, script: 0x57, flags: 0x0}, - 1109: {region: 0x165, script: 0x57, flags: 0x0}, - 1110: {region: 0x165, script: 0x57, flags: 0x0}, - 1111: {region: 0x165, script: 0x57, flags: 0x0}, - 1112: {region: 0x165, script: 0x57, flags: 0x0}, - 1113: {region: 0x165, script: 0x57, flags: 0x0}, - 1114: {region: 0xe7, script: 0x57, flags: 0x0}, - 1115: {region: 0x165, script: 0x57, flags: 0x0}, - 1116: {region: 0x165, script: 0x57, flags: 0x0}, - 1117: {region: 0x99, script: 0x4f, flags: 0x0}, - 1118: {region: 0x53, script: 0xd5, flags: 0x0}, - 1119: {region: 0xdb, script: 0x21, flags: 0x0}, - 1120: {region: 0xdb, script: 0x21, flags: 0x0}, - 1121: {region: 0x99, script: 0xda, flags: 0x0}, - 1122: {region: 0x165, script: 0x57, flags: 0x0}, - 1123: {region: 0x112, script: 0x57, flags: 0x0}, - 1124: {region: 0x131, script: 0x57, flags: 0x0}, - 1125: {region: 0x126, script: 0x57, flags: 0x0}, - 1126: {region: 0x165, script: 0x57, flags: 0x0}, - 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x165, script: 0x57, flags: 0x0}, - 1129: {region: 0x165, script: 0x57, flags: 0x0}, - 1130: {region: 0x165, script: 0x57, flags: 0x0}, - 1131: {region: 0x123, script: 0xdf, flags: 0x0}, - 1132: {region: 0xdb, script: 0x21, flags: 0x0}, - 1133: {region: 0xdb, script: 0x21, flags: 0x0}, - 1134: {region: 0xdb, script: 0x21, flags: 0x0}, - 1135: {region: 0x6f, script: 0x29, flags: 0x0}, - 1136: {region: 0x165, script: 0x57, flags: 0x0}, - 1137: {region: 0x6d, script: 0x29, flags: 0x0}, - 1138: {region: 0x165, script: 0x57, flags: 0x0}, - 1139: {region: 0x165, script: 0x57, flags: 0x0}, - 1140: {region: 0x165, script: 0x57, flags: 0x0}, - 1141: {region: 0xd6, script: 0x57, flags: 0x0}, - 1142: {region: 0x127, script: 0x57, flags: 0x0}, - 1143: {region: 0x125, script: 0x57, flags: 0x0}, - 1144: {region: 0x32, script: 0x57, flags: 0x0}, - 1145: {region: 0xdb, script: 0x21, flags: 0x0}, - 1146: {region: 0xe7, script: 0x57, flags: 0x0}, - 1147: {region: 0x165, script: 0x57, flags: 0x0}, - 1148: {region: 0x165, script: 0x57, flags: 0x0}, - 1149: {region: 0x32, script: 0x57, flags: 0x0}, - 1150: {region: 0xd4, script: 0x57, flags: 0x0}, - 1151: {region: 0x165, script: 0x57, flags: 0x0}, - 1152: {region: 0x161, script: 0x57, flags: 0x0}, - 1153: {region: 0x165, script: 0x57, flags: 0x0}, - 1154: {region: 0x129, script: 0x57, flags: 0x0}, - 1155: {region: 0x165, script: 0x57, flags: 0x0}, - 1156: {region: 0xce, script: 0x57, flags: 0x0}, - 1157: {region: 0x165, script: 0x57, flags: 0x0}, - 1158: {region: 0xe6, script: 0x57, flags: 0x0}, - 1159: {region: 0x165, script: 0x57, flags: 0x0}, - 1160: {region: 0x165, script: 0x57, flags: 0x0}, - 1161: {region: 0x165, script: 0x57, flags: 0x0}, - 1162: {region: 0x12b, script: 0x57, flags: 0x0}, - 1163: {region: 0x12b, script: 0x57, flags: 0x0}, - 1164: {region: 0x12e, script: 0x57, flags: 0x0}, - 1165: {region: 0x165, script: 0x5, flags: 0x0}, - 1166: {region: 0x161, script: 0x57, flags: 0x0}, - 1167: {region: 0x87, script: 0x31, flags: 0x0}, - 1168: {region: 0xdb, script: 0x21, flags: 0x0}, - 1169: {region: 0xe7, script: 0x57, flags: 0x0}, - 1170: {region: 0x43, script: 0xe0, flags: 0x0}, - 1171: {region: 0x165, script: 0x57, flags: 0x0}, - 1172: {region: 0x106, script: 0x1f, flags: 0x0}, - 1173: {region: 0x165, script: 0x57, flags: 0x0}, - 1174: {region: 0x165, script: 0x57, flags: 0x0}, - 1175: {region: 0x131, script: 0x57, flags: 0x0}, - 1176: {region: 0x165, script: 0x57, flags: 0x0}, - 1177: {region: 0x123, script: 0xdf, flags: 0x0}, - 1178: {region: 0x32, script: 0x57, flags: 0x0}, - 1179: {region: 0x165, script: 0x57, flags: 0x0}, - 1180: {region: 0x165, script: 0x57, flags: 0x0}, - 1181: {region: 0xce, script: 0x57, flags: 0x0}, - 1182: {region: 0x165, script: 0x57, flags: 0x0}, - 1183: {region: 0x165, script: 0x57, flags: 0x0}, - 1184: {region: 0x12d, script: 0x57, flags: 0x0}, - 1185: {region: 0x165, script: 0x57, flags: 0x0}, - 1187: {region: 0x165, script: 0x57, flags: 0x0}, - 1188: {region: 0xd4, script: 0x57, flags: 0x0}, - 1189: {region: 0x53, script: 0xd8, flags: 0x0}, - 1190: {region: 0xe5, script: 0x57, flags: 0x0}, - 1191: {region: 0x165, script: 0x57, flags: 0x0}, - 1192: {region: 0x106, script: 0x1f, flags: 0x0}, - 1193: {region: 0xba, script: 0x57, flags: 0x0}, - 1194: {region: 0x165, script: 0x57, flags: 0x0}, - 1195: {region: 0x106, script: 0x1f, flags: 0x0}, - 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11c, script: 0xe2, flags: 0x0}, - 1198: {region: 0x130, script: 0x1f, flags: 0x0}, - 1199: {region: 0x75, script: 0x57, flags: 0x0}, - 1200: {region: 0x2a, script: 0x57, flags: 0x0}, - 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x99, script: 0xe, flags: 0x0}, - 1204: {region: 0xe8, script: 0x5, flags: 0x0}, - 1205: {region: 0x165, script: 0x57, flags: 0x0}, - 1206: {region: 0x165, script: 0x57, flags: 0x0}, - 1207: {region: 0x165, script: 0x57, flags: 0x0}, - 1208: {region: 0x165, script: 0x57, flags: 0x0}, - 1209: {region: 0x165, script: 0x57, flags: 0x0}, - 1210: {region: 0x165, script: 0x57, flags: 0x0}, - 1211: {region: 0x165, script: 0x57, flags: 0x0}, - 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x165, script: 0x57, flags: 0x0}, - 1214: {region: 0xb4, script: 0xe3, flags: 0x0}, - 1215: {region: 0x165, script: 0x57, flags: 0x0}, - 1216: {region: 0x161, script: 0x57, flags: 0x0}, - 1217: {region: 0x9e, script: 0x57, flags: 0x0}, - 1218: {region: 0x106, script: 0x57, flags: 0x0}, - 1219: {region: 0x13e, script: 0x57, flags: 0x0}, - 1220: {region: 0x11b, script: 0x57, flags: 0x0}, - 1221: {region: 0x165, script: 0x57, flags: 0x0}, - 1222: {region: 0x36, script: 0x57, flags: 0x0}, - 1223: {region: 0x60, script: 0x57, flags: 0x0}, - 1224: {region: 0xd1, script: 0x57, flags: 0x0}, - 1225: {region: 0x1, script: 0x57, flags: 0x0}, - 1226: {region: 0x106, script: 0x57, flags: 0x0}, - 1227: {region: 0x6a, script: 0x57, flags: 0x0}, - 1228: {region: 0x12f, script: 0x57, flags: 0x0}, - 1229: {region: 0x165, script: 0x57, flags: 0x0}, - 1230: {region: 0x36, script: 0x57, flags: 0x0}, - 1231: {region: 0x4e, script: 0x57, flags: 0x0}, - 1232: {region: 0x165, script: 0x57, flags: 0x0}, - 1233: {region: 0x6f, script: 0x29, flags: 0x0}, - 1234: {region: 0x165, script: 0x57, flags: 0x0}, - 1235: {region: 0xe7, script: 0x57, flags: 0x0}, - 1236: {region: 0x2f, script: 0x57, flags: 0x0}, - 1237: {region: 0x99, script: 0xda, flags: 0x0}, - 1238: {region: 0x99, script: 0x21, flags: 0x0}, - 1239: {region: 0x165, script: 0x57, flags: 0x0}, - 1240: {region: 0x165, script: 0x57, flags: 0x0}, - 1241: {region: 0x165, script: 0x57, flags: 0x0}, - 1242: {region: 0x165, script: 0x57, flags: 0x0}, - 1243: {region: 0x165, script: 0x57, flags: 0x0}, - 1244: {region: 0x165, script: 0x57, flags: 0x0}, - 1245: {region: 0x165, script: 0x57, flags: 0x0}, - 1246: {region: 0x165, script: 0x57, flags: 0x0}, - 1247: {region: 0x165, script: 0x57, flags: 0x0}, - 1248: {region: 0x140, script: 0x57, flags: 0x0}, - 1249: {region: 0x165, script: 0x57, flags: 0x0}, - 1250: {region: 0x165, script: 0x57, flags: 0x0}, - 1251: {region: 0xa8, script: 0x5, flags: 0x0}, - 1252: {region: 0x165, script: 0x57, flags: 0x0}, - 1253: {region: 0x114, script: 0x57, flags: 0x0}, - 1254: {region: 0x165, script: 0x57, flags: 0x0}, - 1255: {region: 0x165, script: 0x57, flags: 0x0}, - 1256: {region: 0x165, script: 0x57, flags: 0x0}, - 1257: {region: 0x165, script: 0x57, flags: 0x0}, - 1258: {region: 0x99, script: 0x21, flags: 0x0}, - 1259: {region: 0x53, script: 0x38, flags: 0x0}, - 1260: {region: 0x165, script: 0x57, flags: 0x0}, - 1261: {region: 0x165, script: 0x57, flags: 0x0}, - 1262: {region: 0x41, script: 0x57, flags: 0x0}, - 1263: {region: 0x165, script: 0x57, flags: 0x0}, - 1264: {region: 0x12b, script: 0x18, flags: 0x0}, - 1265: {region: 0x165, script: 0x57, flags: 0x0}, - 1266: {region: 0x161, script: 0x57, flags: 0x0}, - 1267: {region: 0x165, script: 0x57, flags: 0x0}, - 1268: {region: 0x12b, script: 0x5f, flags: 0x0}, - 1269: {region: 0x12b, script: 0x60, flags: 0x0}, - 1270: {region: 0x7d, script: 0x2b, flags: 0x0}, - 1271: {region: 0x53, script: 0x64, flags: 0x0}, - 1272: {region: 0x10b, script: 0x69, flags: 0x0}, - 1273: {region: 0x108, script: 0x73, flags: 0x0}, - 1274: {region: 0x99, script: 0x21, flags: 0x0}, - 1275: {region: 0x131, script: 0x57, flags: 0x0}, - 1276: {region: 0x165, script: 0x57, flags: 0x0}, - 1277: {region: 0x9c, script: 0x8a, flags: 0x0}, - 1278: {region: 0x165, script: 0x57, flags: 0x0}, - 1279: {region: 0x15e, script: 0xc2, flags: 0x0}, - 1280: {region: 0x165, script: 0x57, flags: 0x0}, - 1281: {region: 0x165, script: 0x57, flags: 0x0}, - 1282: {region: 0xdb, script: 0x21, flags: 0x0}, - 1283: {region: 0x165, script: 0x57, flags: 0x0}, - 1284: {region: 0x165, script: 0x57, flags: 0x0}, - 1285: {region: 0xd1, script: 0x57, flags: 0x0}, - 1286: {region: 0x75, script: 0x57, flags: 0x0}, - 1287: {region: 0x165, script: 0x57, flags: 0x0}, - 1288: {region: 0x165, script: 0x57, flags: 0x0}, - 1289: {region: 0x52, script: 0x57, flags: 0x0}, - 1290: {region: 0x165, script: 0x57, flags: 0x0}, - 1291: {region: 0x165, script: 0x57, flags: 0x0}, - 1292: {region: 0x165, script: 0x57, flags: 0x0}, - 1293: {region: 0x52, script: 0x57, flags: 0x0}, - 1294: {region: 0x165, script: 0x57, flags: 0x0}, - 1295: {region: 0x165, script: 0x57, flags: 0x0}, - 1296: {region: 0x165, script: 0x57, flags: 0x0}, - 1297: {region: 0x165, script: 0x57, flags: 0x0}, - 1298: {region: 0x1, script: 0x3b, flags: 0x0}, - 1299: {region: 0x165, script: 0x57, flags: 0x0}, - 1300: {region: 0x165, script: 0x57, flags: 0x0}, - 1301: {region: 0x165, script: 0x57, flags: 0x0}, - 1302: {region: 0x165, script: 0x57, flags: 0x0}, - 1303: {region: 0x165, script: 0x57, flags: 0x0}, - 1304: {region: 0xd6, script: 0x57, flags: 0x0}, - 1305: {region: 0x165, script: 0x57, flags: 0x0}, - 1306: {region: 0x165, script: 0x57, flags: 0x0}, - 1307: {region: 0x165, script: 0x57, flags: 0x0}, - 1308: {region: 0x41, script: 0x57, flags: 0x0}, - 1309: {region: 0x165, script: 0x57, flags: 0x0}, - 1310: {region: 0xcf, script: 0x57, flags: 0x0}, - 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x165, script: 0x57, flags: 0x0}, - 1313: {region: 0x165, script: 0x57, flags: 0x0}, - 1314: {region: 0x165, script: 0x57, flags: 0x0}, - 1315: {region: 0x53, script: 0x57, flags: 0x0}, - 1316: {region: 0x10b, script: 0x57, flags: 0x0}, - 1318: {region: 0xa8, script: 0x5, flags: 0x0}, - 1319: {region: 0xd9, script: 0x57, flags: 0x0}, - 1320: {region: 0xba, script: 0xdc, flags: 0x0}, - 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x79, flags: 0x0}, - 1323: {region: 0x165, script: 0x57, flags: 0x0}, - 1324: {region: 0x122, script: 0x57, flags: 0x0}, - 1325: {region: 0xd0, script: 0x57, flags: 0x0}, - 1326: {region: 0x165, script: 0x57, flags: 0x0}, - 1327: {region: 0x161, script: 0x57, flags: 0x0}, - 1329: {region: 0x12b, script: 0x57, flags: 0x0}, -} - -// likelyLangList holds lists info associated with likelyLang. -// Size: 388 bytes, 97 elements -var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x74, flags: 0x2}, - 2: {region: 0x11c, script: 0x80, flags: 0x2}, - 3: {region: 0x32, script: 0x57, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x1f, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x1f, flags: 0x0}, - 9: {region: 0x38, script: 0x2c, flags: 0x2}, - 10: {region: 0x135, script: 0x57, flags: 0x0}, - 11: {region: 0x7b, script: 0xc5, flags: 0x2}, - 12: {region: 0x114, script: 0x57, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1e, flags: 0x0}, - 15: {region: 0x87, script: 0x5c, flags: 0x2}, - 16: {region: 0xd6, script: 0x57, flags: 0x0}, - 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x1f, flags: 0x0}, - 20: {region: 0x24, script: 0x5, flags: 0x4}, - 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, - 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x57, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x1f, flags: 0x0}, - 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x57, flags: 0x4}, - 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x57, flags: 0x2}, - 33: {region: 0xdb, script: 0x21, flags: 0x0}, - 34: {region: 0x99, script: 0x5a, flags: 0x2}, - 35: {region: 0x83, script: 0x57, flags: 0x0}, - 36: {region: 0x84, script: 0x78, flags: 0x4}, - 37: {region: 0x84, script: 0x78, flags: 0x2}, - 38: {region: 0xc5, script: 0x1f, flags: 0x0}, - 39: {region: 0x53, script: 0x6d, flags: 0x4}, - 40: {region: 0x53, script: 0x6d, flags: 0x2}, - 41: {region: 0xd0, script: 0x57, flags: 0x0}, - 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x33, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x84, flags: 0x0}, - 48: {region: 0x53, script: 0x85, flags: 0x2}, - 49: {region: 0xba, script: 0xdc, flags: 0x0}, - 50: {region: 0xd9, script: 0x57, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x21, flags: 0x2}, - 53: {region: 0x99, script: 0x4c, flags: 0x2}, - 54: {region: 0x99, script: 0xc9, flags: 0x2}, - 55: {region: 0x105, script: 0x1f, flags: 0x0}, - 56: {region: 0xbd, script: 0x57, flags: 0x4}, - 57: {region: 0x104, script: 0x57, flags: 0x4}, - 58: {region: 0x106, script: 0x57, flags: 0x4}, - 59: {region: 0x12b, script: 0x57, flags: 0x4}, - 60: {region: 0x124, script: 0x1f, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, - 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x1f, flags: 0x4}, - 65: {region: 0xc5, script: 0x1f, flags: 0x4}, - 66: {region: 0xae, script: 0x1f, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x21, flags: 0x4}, - 69: {region: 0xdb, script: 0x21, flags: 0x2}, - 70: {region: 0x137, script: 0x57, flags: 0x0}, - 71: {region: 0x24, script: 0x5, flags: 0x4}, - 72: {region: 0x53, script: 0x1f, flags: 0x4}, - 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x39, flags: 0x0}, - 75: {region: 0x53, script: 0x38, flags: 0x4}, - 76: {region: 0x53, script: 0x38, flags: 0x2}, - 77: {region: 0x53, script: 0x38, flags: 0x0}, - 78: {region: 0x2f, script: 0x39, flags: 0x4}, - 79: {region: 0x3e, script: 0x39, flags: 0x4}, - 80: {region: 0x7b, script: 0x39, flags: 0x4}, - 81: {region: 0x7e, script: 0x39, flags: 0x4}, - 82: {region: 0x8d, script: 0x39, flags: 0x4}, - 83: {region: 0x95, script: 0x39, flags: 0x4}, - 84: {region: 0xc6, script: 0x39, flags: 0x4}, - 85: {region: 0xd0, script: 0x39, flags: 0x4}, - 86: {region: 0xe2, script: 0x39, flags: 0x4}, - 87: {region: 0xe5, script: 0x39, flags: 0x4}, - 88: {region: 0xe7, script: 0x39, flags: 0x4}, - 89: {region: 0x116, script: 0x39, flags: 0x4}, - 90: {region: 0x123, script: 0x39, flags: 0x4}, - 91: {region: 0x12e, script: 0x39, flags: 0x4}, - 92: {region: 0x135, script: 0x39, flags: 0x4}, - 93: {region: 0x13e, script: 0x39, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x34, flags: 0x2}, - 96: {region: 0x12e, script: 0x39, flags: 0x2}, -} - -type likelyLangScript struct { - lang uint16 - script uint8 - flags uint8 -} - -// likelyRegion is a lookup table, indexed by regionID, for the most likely -// languages and scripts given incomplete information. If more entries exist -// for a given regionID, lang and script are the index and size respectively -// of the list in likelyRegionList. -// TODO: exclude containers and user-definable regions from the list. -// Size: 1432 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x57, flags: 0x0}, - 35: {lang: 0x3a, script: 0x5, flags: 0x0}, - 36: {lang: 0x0, script: 0x2, flags: 0x1}, - 39: {lang: 0x2, script: 0x2, flags: 0x1}, - 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 43: {lang: 0x0, script: 0x57, flags: 0x0}, - 44: {lang: 0x13e, script: 0x57, flags: 0x0}, - 45: {lang: 0x41b, script: 0x57, flags: 0x0}, - 46: {lang: 0x10d, script: 0x57, flags: 0x0}, - 48: {lang: 0x367, script: 0x57, flags: 0x0}, - 49: {lang: 0x444, script: 0x57, flags: 0x0}, - 50: {lang: 0x58, script: 0x57, flags: 0x0}, - 51: {lang: 0x6, script: 0x2, flags: 0x1}, - 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x57, flags: 0x0}, - 55: {lang: 0x15e, script: 0x57, flags: 0x0}, - 56: {lang: 0x7e, script: 0x1f, flags: 0x0}, - 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x57, flags: 0x0}, - 59: {lang: 0x15e, script: 0x57, flags: 0x0}, - 60: {lang: 0x15e, script: 0x57, flags: 0x0}, - 62: {lang: 0x31f, script: 0x57, flags: 0x0}, - 63: {lang: 0x13e, script: 0x57, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x57, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x57, flags: 0x0}, - 71: {lang: 0x71, script: 0x1f, flags: 0x0}, - 73: {lang: 0x512, script: 0x3b, flags: 0x2}, - 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x57, flags: 0x0}, - 76: {lang: 0x15e, script: 0x57, flags: 0x0}, - 77: {lang: 0x15e, script: 0x57, flags: 0x0}, - 78: {lang: 0x10d, script: 0x57, flags: 0x0}, - 79: {lang: 0x15e, script: 0x57, flags: 0x0}, - 81: {lang: 0x13e, script: 0x57, flags: 0x0}, - 82: {lang: 0x15e, script: 0x57, flags: 0x0}, - 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x57, flags: 0x0}, - 85: {lang: 0x0, script: 0x57, flags: 0x0}, - 86: {lang: 0x13e, script: 0x57, flags: 0x0}, - 89: {lang: 0x13e, script: 0x57, flags: 0x0}, - 90: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 91: {lang: 0x3a1, script: 0x57, flags: 0x0}, - 93: {lang: 0xe, script: 0x2, flags: 0x1}, - 94: {lang: 0xfa, script: 0x57, flags: 0x0}, - 96: {lang: 0x10d, script: 0x57, flags: 0x0}, - 98: {lang: 0x1, script: 0x57, flags: 0x0}, - 99: {lang: 0x101, script: 0x57, flags: 0x0}, - 101: {lang: 0x13e, script: 0x57, flags: 0x0}, - 103: {lang: 0x10, script: 0x2, flags: 0x1}, - 104: {lang: 0x13e, script: 0x57, flags: 0x0}, - 105: {lang: 0x13e, script: 0x57, flags: 0x0}, - 106: {lang: 0x140, script: 0x57, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, - 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46f, script: 0x29, flags: 0x0}, - 110: {lang: 0x13e, script: 0x57, flags: 0x0}, - 111: {lang: 0x12, script: 0x2, flags: 0x1}, - 113: {lang: 0x10d, script: 0x57, flags: 0x0}, - 114: {lang: 0x151, script: 0x57, flags: 0x0}, - 115: {lang: 0x1c0, script: 0x21, flags: 0x2}, - 118: {lang: 0x158, script: 0x57, flags: 0x0}, - 120: {lang: 0x15e, script: 0x57, flags: 0x0}, - 122: {lang: 0x15e, script: 0x57, flags: 0x0}, - 123: {lang: 0x14, script: 0x2, flags: 0x1}, - 125: {lang: 0x16, script: 0x3, flags: 0x1}, - 126: {lang: 0x15e, script: 0x57, flags: 0x0}, - 128: {lang: 0x21, script: 0x57, flags: 0x0}, - 130: {lang: 0x245, script: 0x57, flags: 0x0}, - 132: {lang: 0x15e, script: 0x57, flags: 0x0}, - 133: {lang: 0x15e, script: 0x57, flags: 0x0}, - 134: {lang: 0x13e, script: 0x57, flags: 0x0}, - 135: {lang: 0x19, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x57, flags: 0x0}, - 137: {lang: 0x13e, script: 0x57, flags: 0x0}, - 139: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 141: {lang: 0x529, script: 0x39, flags: 0x0}, - 142: {lang: 0x0, script: 0x57, flags: 0x0}, - 143: {lang: 0x13e, script: 0x57, flags: 0x0}, - 144: {lang: 0x1d1, script: 0x57, flags: 0x0}, - 145: {lang: 0x1d4, script: 0x57, flags: 0x0}, - 146: {lang: 0x1d5, script: 0x57, flags: 0x0}, - 148: {lang: 0x13e, script: 0x57, flags: 0x0}, - 149: {lang: 0x1b, script: 0x2, flags: 0x1}, - 151: {lang: 0x1bc, script: 0x3b, flags: 0x0}, - 153: {lang: 0x1d, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x20, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f8, script: 0x57, flags: 0x0}, - 158: {lang: 0x1f9, script: 0x57, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x200, script: 0x46, flags: 0x0}, - 164: {lang: 0x445, script: 0x57, flags: 0x0}, - 165: {lang: 0x28a, script: 0x1f, flags: 0x0}, - 166: {lang: 0x22, script: 0x3, flags: 0x1}, - 168: {lang: 0x25, script: 0x2, flags: 0x1}, - 170: {lang: 0x254, script: 0x50, flags: 0x0}, - 171: {lang: 0x254, script: 0x50, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e2, script: 0x1f, flags: 0x0}, - 175: {lang: 0x27, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10d, script: 0x57, flags: 0x0}, - 179: {lang: 0x40c, script: 0xca, flags: 0x0}, - 181: {lang: 0x43b, script: 0x57, flags: 0x0}, - 182: {lang: 0x2c0, script: 0x57, flags: 0x0}, - 183: {lang: 0x15e, script: 0x57, flags: 0x0}, - 184: {lang: 0x2c7, script: 0x57, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x29, script: 0x2, flags: 0x1}, - 187: {lang: 0x15e, script: 0x57, flags: 0x0}, - 188: {lang: 0x2b, script: 0x2, flags: 0x1}, - 189: {lang: 0x432, script: 0x57, flags: 0x0}, - 190: {lang: 0x15e, script: 0x57, flags: 0x0}, - 191: {lang: 0x2f1, script: 0x57, flags: 0x0}, - 194: {lang: 0x2d, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x57, flags: 0x0}, - 196: {lang: 0x2f, script: 0x2, flags: 0x1}, - 197: {lang: 0x31, script: 0x2, flags: 0x1}, - 198: {lang: 0x33, script: 0x2, flags: 0x1}, - 200: {lang: 0x15e, script: 0x57, flags: 0x0}, - 201: {lang: 0x35, script: 0x2, flags: 0x1}, - 203: {lang: 0x320, script: 0x57, flags: 0x0}, - 204: {lang: 0x37, script: 0x3, flags: 0x1}, - 205: {lang: 0x128, script: 0xde, flags: 0x0}, - 207: {lang: 0x13e, script: 0x57, flags: 0x0}, - 208: {lang: 0x31f, script: 0x57, flags: 0x0}, - 209: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 210: {lang: 0x16, script: 0x57, flags: 0x0}, - 211: {lang: 0x15e, script: 0x57, flags: 0x0}, - 212: {lang: 0x1b4, script: 0x57, flags: 0x0}, - 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 216: {lang: 0x13e, script: 0x57, flags: 0x0}, - 217: {lang: 0x367, script: 0x57, flags: 0x0}, - 218: {lang: 0x347, script: 0x57, flags: 0x0}, - 219: {lang: 0x351, script: 0x21, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13e, script: 0x57, flags: 0x0}, - 228: {lang: 0x13e, script: 0x57, flags: 0x0}, - 229: {lang: 0x15e, script: 0x57, flags: 0x0}, - 230: {lang: 0x486, script: 0x57, flags: 0x0}, - 231: {lang: 0x153, script: 0x57, flags: 0x0}, - 232: {lang: 0x3a, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b3, script: 0x57, flags: 0x0}, - 234: {lang: 0x15e, script: 0x57, flags: 0x0}, - 236: {lang: 0x13e, script: 0x57, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 240: {lang: 0x3a2, script: 0x57, flags: 0x0}, - 241: {lang: 0x194, script: 0x57, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15e, script: 0x57, flags: 0x0}, - 260: {lang: 0x3d, script: 0x2, flags: 0x1}, - 261: {lang: 0x432, script: 0x1f, flags: 0x0}, - 262: {lang: 0x3f, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e5, script: 0x57, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15e, script: 0x57, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x41, script: 0x2, flags: 0x1}, - 271: {lang: 0x416, script: 0x57, flags: 0x0}, - 272: {lang: 0x347, script: 0x57, flags: 0x0}, - 273: {lang: 0x43, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f9, script: 0x57, flags: 0x0}, - 276: {lang: 0x15e, script: 0x57, flags: 0x0}, - 277: {lang: 0x429, script: 0x57, flags: 0x0}, - 278: {lang: 0x367, script: 0x57, flags: 0x0}, - 280: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 282: {lang: 0x13e, script: 0x57, flags: 0x0}, - 284: {lang: 0x45, script: 0x2, flags: 0x1}, - 288: {lang: 0x15e, script: 0x57, flags: 0x0}, - 289: {lang: 0x15e, script: 0x57, flags: 0x0}, - 290: {lang: 0x47, script: 0x2, flags: 0x1}, - 291: {lang: 0x49, script: 0x3, flags: 0x1}, - 292: {lang: 0x4c, script: 0x2, flags: 0x1}, - 293: {lang: 0x477, script: 0x57, flags: 0x0}, - 294: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 295: {lang: 0x476, script: 0x57, flags: 0x0}, - 296: {lang: 0x4e, script: 0x2, flags: 0x1}, - 297: {lang: 0x482, script: 0x57, flags: 0x0}, - 299: {lang: 0x50, script: 0x4, flags: 0x1}, - 301: {lang: 0x4a0, script: 0x57, flags: 0x0}, - 302: {lang: 0x54, script: 0x2, flags: 0x1}, - 303: {lang: 0x445, script: 0x57, flags: 0x0}, - 304: {lang: 0x56, script: 0x3, flags: 0x1}, - 305: {lang: 0x445, script: 0x57, flags: 0x0}, - 309: {lang: 0x512, script: 0x3b, flags: 0x2}, - 310: {lang: 0x13e, script: 0x57, flags: 0x0}, - 311: {lang: 0x4bc, script: 0x57, flags: 0x0}, - 312: {lang: 0x1f9, script: 0x57, flags: 0x0}, - 315: {lang: 0x13e, script: 0x57, flags: 0x0}, - 318: {lang: 0x4c3, script: 0x57, flags: 0x0}, - 319: {lang: 0x8a, script: 0x57, flags: 0x0}, - 320: {lang: 0x15e, script: 0x57, flags: 0x0}, - 322: {lang: 0x41b, script: 0x57, flags: 0x0}, - 333: {lang: 0x59, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5b, script: 0x2, flags: 0x1}, - 356: {lang: 0x423, script: 0x57, flags: 0x0}, -} - -// likelyRegionList holds lists info associated with likelyRegion. -// Size: 372 bytes, 93 elements -var likelyRegionList = [93]likelyLangScript{ - 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x57, flags: 0x0}, - 2: {lang: 0x431, script: 0x57, flags: 0x0}, - 3: {lang: 0x2ff, script: 0x1f, flags: 0x0}, - 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x57, flags: 0x0}, - 6: {lang: 0xb7, script: 0x57, flags: 0x0}, - 7: {lang: 0x432, script: 0x1f, flags: 0x0}, - 8: {lang: 0x12d, script: 0xe0, flags: 0x0}, - 9: {lang: 0x351, script: 0x21, flags: 0x0}, - 10: {lang: 0x529, script: 0x38, flags: 0x0}, - 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x57, flags: 0x0}, - 13: {lang: 0x29a, script: 0xdf, flags: 0x0}, - 14: {lang: 0x136, script: 0x31, flags: 0x0}, - 15: {lang: 0x48a, script: 0x57, flags: 0x0}, - 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x57, flags: 0x0}, - 18: {lang: 0x27, script: 0x29, flags: 0x0}, - 19: {lang: 0x139, script: 0x57, flags: 0x0}, - 20: {lang: 0x26a, script: 0x5, flags: 0x2}, - 21: {lang: 0x512, script: 0x3b, flags: 0x2}, - 22: {lang: 0x210, script: 0x2b, flags: 0x0}, - 23: {lang: 0x5, script: 0x1f, flags: 0x0}, - 24: {lang: 0x274, script: 0x57, flags: 0x0}, - 25: {lang: 0x136, script: 0x31, flags: 0x0}, - 26: {lang: 0x2ff, script: 0x1f, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x57, flags: 0x0}, - 28: {lang: 0x31f, script: 0x5, flags: 0x0}, - 29: {lang: 0x1be, script: 0x21, flags: 0x0}, - 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x72, flags: 0x0}, - 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x57, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4b, flags: 0x0}, - 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xdf, flags: 0x0}, - 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x57, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x54, flags: 0x0}, - 40: {lang: 0x226, script: 0xdf, flags: 0x0}, - 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x57, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x57, flags: 0x0}, - 44: {lang: 0x4ae, script: 0x1f, flags: 0x0}, - 45: {lang: 0x2ff, script: 0x1f, flags: 0x0}, - 46: {lang: 0x431, script: 0x57, flags: 0x0}, - 47: {lang: 0x331, script: 0x72, flags: 0x0}, - 48: {lang: 0x213, script: 0x57, flags: 0x0}, - 49: {lang: 0x30b, script: 0x1f, flags: 0x0}, - 50: {lang: 0x242, script: 0x5, flags: 0x0}, - 51: {lang: 0x529, script: 0x39, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x57, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x57, flags: 0x0}, - 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 57: {lang: 0x88, script: 0x21, flags: 0x0}, - 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 60: {lang: 0xbe, script: 0x21, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x57, flags: 0x0}, - 62: {lang: 0x7e, script: 0x1f, flags: 0x0}, - 63: {lang: 0x3e2, script: 0x1f, flags: 0x0}, - 64: {lang: 0x267, script: 0x57, flags: 0x0}, - 65: {lang: 0x444, script: 0x57, flags: 0x0}, - 66: {lang: 0x512, script: 0x3b, flags: 0x0}, - 67: {lang: 0x412, script: 0x57, flags: 0x0}, - 68: {lang: 0x4ae, script: 0x1f, flags: 0x0}, - 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x57, flags: 0x0}, - 71: {lang: 0x15e, script: 0x57, flags: 0x0}, - 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xdf, flags: 0x0}, - 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x72, flags: 0x0}, - 76: {lang: 0x467, script: 0x1f, flags: 0x0}, - 77: {lang: 0x148, script: 0x5, flags: 0x0}, - 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x57, flags: 0x0}, - 80: {lang: 0x48a, script: 0x57, flags: 0x0}, - 81: {lang: 0x58, script: 0x5, flags: 0x0}, - 82: {lang: 0x219, script: 0x1f, flags: 0x0}, - 83: {lang: 0x81, script: 0x31, flags: 0x0}, - 84: {lang: 0x529, script: 0x39, flags: 0x0}, - 85: {lang: 0x48c, script: 0x57, flags: 0x0}, - 86: {lang: 0x4ae, script: 0x1f, flags: 0x0}, - 87: {lang: 0x512, script: 0x3b, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x57, flags: 0x0}, - 89: {lang: 0x431, script: 0x57, flags: 0x0}, - 90: {lang: 0x432, script: 0x1f, flags: 0x0}, - 91: {lang: 0x15e, script: 0x57, flags: 0x0}, - 92: {lang: 0x446, script: 0x5, flags: 0x0}, -} - -type likelyTag struct { - lang uint16 - region uint16 - script uint8 -} - -// Size: 198 bytes, 33 elements -var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd6, script: 0x57}, - 2: {lang: 0x139, region: 0x135, script: 0x57}, - 3: {lang: 0x3c0, region: 0x41, script: 0x57}, - 4: {lang: 0x139, region: 0x2f, script: 0x57}, - 5: {lang: 0x139, region: 0xd6, script: 0x57}, - 6: {lang: 0x13e, region: 0xcf, script: 0x57}, - 7: {lang: 0x445, region: 0x12f, script: 0x57}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x57}, - 10: {lang: 0x139, region: 0x161, script: 0x57}, - 11: {lang: 0x139, region: 0x135, script: 0x57}, - 12: {lang: 0x139, region: 0x135, script: 0x57}, - 13: {lang: 0x13e, region: 0x59, script: 0x57}, - 14: {lang: 0x529, region: 0x53, script: 0x38}, - 15: {lang: 0x1be, region: 0x99, script: 0x21}, - 16: {lang: 0x1e1, region: 0x95, script: 0x57}, - 17: {lang: 0x1f9, region: 0x9e, script: 0x57}, - 18: {lang: 0x139, region: 0x2f, script: 0x57}, - 19: {lang: 0x139, region: 0xe6, script: 0x57}, - 20: {lang: 0x139, region: 0x8a, script: 0x57}, - 21: {lang: 0x41b, region: 0x142, script: 0x57}, - 22: {lang: 0x529, region: 0x53, script: 0x38}, - 23: {lang: 0x4bc, region: 0x137, script: 0x57}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e2, region: 0x106, script: 0x1f}, - 26: {lang: 0x3e2, region: 0x106, script: 0x1f}, - 27: {lang: 0x139, region: 0x7b, script: 0x57}, - 28: {lang: 0x10d, region: 0x60, script: 0x57}, - 29: {lang: 0x139, region: 0xd6, script: 0x57}, - 30: {lang: 0x13e, region: 0x1f, script: 0x57}, - 31: {lang: 0x139, region: 0x9a, script: 0x57}, - 32: {lang: 0x139, region: 0x7b, script: 0x57}, -} - -// Size: 264 bytes, 33 elements -var regionContainment = [33]uint64{ - // Entry 0 - 1F - 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, - 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, - 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, - 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, - 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, - 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, - 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, - 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, - // Entry 20 - 3F - 0x0000000100000000, -} - -// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, -// where each set holds all groupings that are directly connected in a region -// containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, - 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, - 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, - 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, - 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, - 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, - 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, - 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, - // Entry 40 - 7F - 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, - 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, - // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, - // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, - // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, -} - -// regionInclusionBits is an array of bit vectors where every vector represents -// a set of region groupings. These sets are used to compute the distance -// between two regions for the purpose of language matching. -// Size: 584 bytes, 73 elements -var regionInclusionBits = [73]uint64{ - // Entry 0 - 1F - 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, - 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, - 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, - 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, - 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, - 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, - 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, - 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, - // Entry 20 - 3F - 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, - 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, - 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, - 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, - 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, - 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, - 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, - 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, - // Entry 40 - 5F - 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, - 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, - 0x0000000102020001, -} - -// regionInclusionNext marks, for each entry in regionInclusionBits, the set of -// all groups that are reachable from the groups set in the respective entry. -// Size: 73 bytes, 73 elements -var regionInclusionNext = [73]uint8{ - // Entry 0 - 3F - 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, - 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, - 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, - 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, - 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, - 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, - 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, - 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, - // Entry 40 - 7F - 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, - 0x43, -} - -type parentRel struct { - lang uint16 - script uint8 - maxScript uint8 - toRegion uint16 - fromRegion []uint16 -} - -// Size: 414 bytes, 5 elements -var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, -} - -// Total table size 25886 bytes (25KiB); checksum: 50D3D57D diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go deleted file mode 100644 index e7afd318..00000000 --- a/vendor/golang.org/x/text/internal/language/tags.go +++ /dev/null @@ -1,48 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. -// It simplifies safe initialization of Tag values. -func MustParse(s string) Tag { - t, err := Parse(s) - if err != nil { - panic(err) - } - return t -} - -// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. -// It simplifies safe initialization of Base values. -func MustParseBase(s string) Language { - b, err := ParseBase(s) - if err != nil { - panic(err) - } - return b -} - -// MustParseScript is like ParseScript, but panics if the given script cannot be -// parsed. It simplifies safe initialization of Script values. -func MustParseScript(s string) Script { - scr, err := ParseScript(s) - if err != nil { - panic(err) - } - return scr -} - -// MustParseRegion is like ParseRegion, but panics if the given region cannot be -// parsed. It simplifies safe initialization of Region values. -func MustParseRegion(s string) Region { - r, err := ParseRegion(s) - if err != nil { - panic(err) - } - return r -} - -// Und is the root language. -var Und Tag diff --git a/vendor/golang.org/x/text/internal/tag/LICENSE b/vendor/golang.org/x/text/internal/tag/LICENSE deleted file mode 100644 index 6a66aea5..00000000 --- a/vendor/golang.org/x/text/internal/tag/LICENSE +++ /dev/null @@ -1,27 +0,0 @@ -Copyright (c) 2009 The Go Authors. All rights reserved. - -Redistribution and use in source and binary forms, with or without -modification, are permitted provided that the following conditions are -met: - - * Redistributions of source code must retain the above copyright -notice, this list of conditions and the following disclaimer. - * Redistributions in binary form must reproduce the above -copyright notice, this list of conditions and the following disclaimer -in the documentation and/or other materials provided with the -distribution. - * Neither the name of Google Inc. nor the names of its -contributors may be used to endorse or promote products derived from -this software without specific prior written permission. - -THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS -"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT -LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR -A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT -OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, -SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT -LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, -DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY -THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT -(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE -OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go deleted file mode 100644 index b5d34889..00000000 --- a/vendor/golang.org/x/text/internal/tag/tag.go +++ /dev/null @@ -1,100 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package tag contains functionality handling tags and related data. -package tag // import "golang.org/x/text/internal/tag" - -import "sort" - -// An Index converts tags to a compact numeric value. -// -// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can -// be used to store additional information about the tag. -type Index string - -// Elem returns the element data at the given index. -func (s Index) Elem(x int) string { - return string(s[x*4 : x*4+4]) -} - -// Index reports the index of the given key or -1 if it could not be found. -// Only the first len(key) bytes from the start of the 4-byte entries will be -// considered for the search and the first match in Index will be returned. -func (s Index) Index(key []byte) int { - n := len(key) - // search the index of the first entry with an equal or higher value than - // key in s. - index := sort.Search(len(s)/4, func(i int) bool { - return cmp(s[i*4:i*4+n], key) != -1 - }) - i := index * 4 - if cmp(s[i:i+len(key)], key) != 0 { - return -1 - } - return index -} - -// Next finds the next occurrence of key after index x, which must have been -// obtained from a call to Index using the same key. It returns x+1 or -1. -func (s Index) Next(key []byte, x int) int { - if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 { - return x - } - return -1 -} - -// cmp returns an integer comparing a and b lexicographically. -func cmp(a Index, b []byte) int { - n := len(a) - if len(b) < n { - n = len(b) - } - for i, c := range b[:n] { - switch { - case a[i] > c: - return 1 - case a[i] < c: - return -1 - } - } - switch { - case len(a) < len(b): - return -1 - case len(a) > len(b): - return 1 - } - return 0 -} - -// Compare returns an integer comparing a and b lexicographically. -func Compare(a string, b []byte) int { - return cmp(Index(a), b) -} - -// FixCase reformats b to the same pattern of cases as form. -// If returns false if string b is malformed. -func FixCase(form string, b []byte) bool { - if len(form) != len(b) { - return false - } - for i, c := range b { - if form[i] <= 'Z' { - if c >= 'a' { - c -= 'z' - 'Z' - } - if c < 'A' || 'Z' < c { - return false - } - } else { - if c <= 'Z' { - c += 'z' - 'Z' - } - if c < 'a' || 'z' < c { - return false - } - } - b[i] = c - } - return true -} diff --git a/vendor/golang.org/x/text/internal/triegen/LICENSE b/vendor/golang.org/x/text/internal/triegen/LICENSE deleted file mode 100644 index 6a66aea5..00000000 --- a/vendor/golang.org/x/text/internal/triegen/LICENSE +++ /dev/null @@ -1,27 +0,0 @@ -Copyright (c) 2009 The Go Authors. All rights reserved. - -Redistribution and use in source and binary forms, with or without -modification, are permitted provided that the following conditions are -met: - - * Redistributions of source code must retain the above copyright -notice, this list of conditions and the following disclaimer. - * Redistributions in binary form must reproduce the above -copyright notice, this list of conditions and the following disclaimer -in the documentation and/or other materials provided with the -distribution. - * Neither the name of Google Inc. nor the names of its -contributors may be used to endorse or promote products derived from -this software without specific prior written permission. - -THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS -"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT -LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR -A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT -OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, -SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT -LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, -DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY -THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT -(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE -OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/golang.org/x/text/internal/triegen/compact.go b/vendor/golang.org/x/text/internal/triegen/compact.go deleted file mode 100644 index 397b975c..00000000 --- a/vendor/golang.org/x/text/internal/triegen/compact.go +++ /dev/null @@ -1,58 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package triegen - -// This file defines Compacter and its implementations. - -import "io" - -// A Compacter generates an alternative, more space-efficient way to store a -// trie value block. A trie value block holds all possible values for the last -// byte of a UTF-8 encoded rune. Excluding ASCII characters, a trie value block -// always has 64 values, as a UTF-8 encoding ends with a byte in [0x80, 0xC0). -type Compacter interface { - // Size returns whether the Compacter could encode the given block as well - // as its size in case it can. len(v) is always 64. - Size(v []uint64) (sz int, ok bool) - - // Store stores the block using the Compacter's compression method. - // It returns a handle with which the block can be retrieved. - // len(v) is always 64. - Store(v []uint64) uint32 - - // Print writes the data structures associated to the given store to w. - Print(w io.Writer) error - - // Handler returns the name of a function that gets called during trie - // lookup for blocks generated by the Compacter. The function should be of - // the form func (n uint32, b byte) uint64, where n is the index returned by - // the Compacter's Store method and b is the last byte of the UTF-8 - // encoding, where 0x80 <= b < 0xC0, for which to do the lookup in the - // block. - Handler() string -} - -// simpleCompacter is the default Compacter used by builder. It implements a -// normal trie block. -type simpleCompacter builder - -func (b *simpleCompacter) Size([]uint64) (sz int, ok bool) { - return blockSize * b.ValueSize, true -} - -func (b *simpleCompacter) Store(v []uint64) uint32 { - h := uint32(len(b.ValueBlocks) - blockOffset) - b.ValueBlocks = append(b.ValueBlocks, v) - return h -} - -func (b *simpleCompacter) Print(io.Writer) error { - // Structures are printed in print.go. - return nil -} - -func (b *simpleCompacter) Handler() string { - panic("Handler should be special-cased for this Compacter") -} diff --git a/vendor/golang.org/x/text/internal/triegen/print.go b/vendor/golang.org/x/text/internal/triegen/print.go deleted file mode 100644 index 8d9f120b..00000000 --- a/vendor/golang.org/x/text/internal/triegen/print.go +++ /dev/null @@ -1,251 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package triegen - -import ( - "bytes" - "fmt" - "io" - "strings" - "text/template" -) - -// print writes all the data structures as well as the code necessary to use the -// trie to w. -func (b *builder) print(w io.Writer) error { - b.Stats.NValueEntries = len(b.ValueBlocks) * blockSize - b.Stats.NValueBytes = len(b.ValueBlocks) * blockSize * b.ValueSize - b.Stats.NIndexEntries = len(b.IndexBlocks) * blockSize - b.Stats.NIndexBytes = len(b.IndexBlocks) * blockSize * b.IndexSize - b.Stats.NHandleBytes = len(b.Trie) * 2 * b.IndexSize - - // If we only have one root trie, all starter blocks are at position 0 and - // we can access the arrays directly. - if len(b.Trie) == 1 { - // At this point we cannot refer to the generated tables directly. - b.ASCIIBlock = b.Name + "Values" - b.StarterBlock = b.Name + "Index" - } else { - // Otherwise we need to have explicit starter indexes in the trie - // structure. - b.ASCIIBlock = "t.ascii" - b.StarterBlock = "t.utf8Start" - } - - b.SourceType = "[]byte" - if err := lookupGen.Execute(w, b); err != nil { - return err - } - - b.SourceType = "string" - if err := lookupGen.Execute(w, b); err != nil { - return err - } - - if err := trieGen.Execute(w, b); err != nil { - return err - } - - for _, c := range b.Compactions { - if err := c.c.Print(w); err != nil { - return err - } - } - - return nil -} - -func printValues(n int, values []uint64) string { - w := &bytes.Buffer{} - boff := n * blockSize - fmt.Fprintf(w, "\t// Block %#x, offset %#x", n, boff) - var newline bool - for i, v := range values { - if i%6 == 0 { - newline = true - } - if v != 0 { - if newline { - fmt.Fprintf(w, "\n") - newline = false - } - fmt.Fprintf(w, "\t%#02x:%#04x, ", boff+i, v) - } - } - return w.String() -} - -func printIndex(b *builder, nr int, n *node) string { - w := &bytes.Buffer{} - boff := nr * blockSize - fmt.Fprintf(w, "\t// Block %#x, offset %#x", nr, boff) - var newline bool - for i, c := range n.children { - if i%8 == 0 { - newline = true - } - if c != nil { - v := b.Compactions[c.index.compaction].Offset + uint32(c.index.index) - if v != 0 { - if newline { - fmt.Fprintf(w, "\n") - newline = false - } - fmt.Fprintf(w, "\t%#02x:%#02x, ", boff+i, v) - } - } - } - return w.String() -} - -var ( - trieGen = template.Must(template.New("trie").Funcs(template.FuncMap{ - "printValues": printValues, - "printIndex": printIndex, - "title": strings.Title, - "dec": func(x int) int { return x - 1 }, - "psize": func(n int) string { - return fmt.Sprintf("%d bytes (%.2f KiB)", n, float64(n)/1024) - }, - }).Parse(trieTemplate)) - lookupGen = template.Must(template.New("lookup").Parse(lookupTemplate)) -) - -// TODO: consider the return type of lookup. It could be uint64, even if the -// internal value type is smaller. We will have to verify this with the -// performance of unicode/norm, which is very sensitive to such changes. -const trieTemplate = `{{$b := .}}{{$multi := gt (len .Trie) 1}} -// {{.Name}}Trie. Total size: {{psize .Size}}. Checksum: {{printf "%08x" .Checksum}}. -type {{.Name}}Trie struct { {{if $multi}} - ascii []{{.ValueType}} // index for ASCII bytes - utf8Start []{{.IndexType}} // index for UTF-8 bytes >= 0xC0 -{{end}}} - -func new{{title .Name}}Trie(i int) *{{.Name}}Trie { {{if $multi}} - h := {{.Name}}TrieHandles[i] - return &{{.Name}}Trie{ {{.Name}}Values[uint32(h.ascii)<<6:], {{.Name}}Index[uint32(h.multi)<<6:] } -} - -type {{.Name}}TrieHandle struct { - ascii, multi {{.IndexType}} -} - -// {{.Name}}TrieHandles: {{len .Trie}} handles, {{.Stats.NHandleBytes}} bytes -var {{.Name}}TrieHandles = [{{len .Trie}}]{{.Name}}TrieHandle{ -{{range .Trie}} { {{.ASCIIIndex}}, {{.StarterIndex}} }, // {{printf "%08x" .Checksum}}: {{.Name}} -{{end}}}{{else}} - return &{{.Name}}Trie{} -} -{{end}} -// lookupValue determines the type of block n and looks up the value for b. -func (t *{{.Name}}Trie) lookupValue(n uint32, b byte) {{.ValueType}}{{$last := dec (len .Compactions)}} { - switch { {{range $i, $c := .Compactions}} - {{if eq $i $last}}default{{else}}case n < {{$c.Cutoff}}{{end}}:{{if ne $i 0}} - n -= {{$c.Offset}}{{end}} - return {{print $b.ValueType}}({{$c.Handler}}){{end}} - } -} - -// {{.Name}}Values: {{len .ValueBlocks}} blocks, {{.Stats.NValueEntries}} entries, {{.Stats.NValueBytes}} bytes -// The third block is the zero block. -var {{.Name}}Values = [{{.Stats.NValueEntries}}]{{.ValueType}} { -{{range $i, $v := .ValueBlocks}}{{printValues $i $v}} -{{end}}} - -// {{.Name}}Index: {{len .IndexBlocks}} blocks, {{.Stats.NIndexEntries}} entries, {{.Stats.NIndexBytes}} bytes -// Block 0 is the zero block. -var {{.Name}}Index = [{{.Stats.NIndexEntries}}]{{.IndexType}} { -{{range $i, $v := .IndexBlocks}}{{printIndex $b $i $v}} -{{end}}} -` - -// TODO: consider allowing zero-length strings after evaluating performance with -// unicode/norm. -const lookupTemplate = ` -// lookup{{if eq .SourceType "string"}}String{{end}} returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *{{.Name}}Trie) lookup{{if eq .SourceType "string"}}String{{end}}(s {{.SourceType}}) (v {{.ValueType}}, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return {{.ASCIIBlock}}[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := {{.StarterBlock}}[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := {{.StarterBlock}}[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = {{.Name}}Index[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := {{.StarterBlock}}[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = {{.Name}}Index[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = {{.Name}}Index[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookup{{if eq .SourceType "string"}}String{{end}}Unsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *{{.Name}}Trie) lookup{{if eq .SourceType "string"}}String{{end}}Unsafe(s {{.SourceType}}) {{.ValueType}} { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return {{.ASCIIBlock}}[c0] - } - i := {{.StarterBlock}}[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = {{.Name}}Index[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = {{.Name}}Index[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} -` diff --git a/vendor/golang.org/x/text/internal/triegen/triegen.go b/vendor/golang.org/x/text/internal/triegen/triegen.go deleted file mode 100644 index adb01081..00000000 --- a/vendor/golang.org/x/text/internal/triegen/triegen.go +++ /dev/null @@ -1,494 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package triegen implements a code generator for a trie for associating -// unsigned integer values with UTF-8 encoded runes. -// -// Many of the go.text packages use tries for storing per-rune information. A -// trie is especially useful if many of the runes have the same value. If this -// is the case, many blocks can be expected to be shared allowing for -// information on many runes to be stored in little space. -// -// As most of the lookups are done directly on []byte slices, the tries use the -// UTF-8 bytes directly for the lookup. This saves a conversion from UTF-8 to -// runes and contributes a little bit to better performance. It also naturally -// provides a fast path for ASCII. -// -// Space is also an issue. There are many code points defined in Unicode and as -// a result tables can get quite large. So every byte counts. The triegen -// package automatically chooses the smallest integer values to represent the -// tables. Compacters allow further compression of the trie by allowing for -// alternative representations of individual trie blocks. -// -// triegen allows generating multiple tries as a single structure. This is -// useful when, for example, one wants to generate tries for several languages -// that have a lot of values in common. Some existing libraries for -// internationalization store all per-language data as a dynamically loadable -// chunk. The go.text packages are designed with the assumption that the user -// typically wants to compile in support for all supported languages, in line -// with the approach common to Go to create a single standalone binary. The -// multi-root trie approach can give significant storage savings in this -// scenario. -// -// triegen generates both tables and code. The code is optimized to use the -// automatically chosen data types. The following code is generated for a Trie -// or multiple Tries named "foo": -// - type fooTrie -// The trie type. -// -// - func newFooTrie(x int) *fooTrie -// Trie constructor, where x is the index of the trie passed to Gen. -// -// - func (t *fooTrie) lookup(s []byte) (v uintX, sz int) -// The lookup method, where uintX is automatically chosen. -// -// - func lookupString, lookupUnsafe and lookupStringUnsafe -// Variants of the above. -// -// - var fooValues and fooIndex and any tables generated by Compacters. -// The core trie data. -// -// - var fooTrieHandles -// Indexes of starter blocks in case of multiple trie roots. -// -// It is recommended that users test the generated trie by checking the returned -// value for every rune. Such exhaustive tests are possible as the the number of -// runes in Unicode is limited. -package triegen // import "golang.org/x/text/internal/triegen" - -// TODO: Arguably, the internally optimized data types would not have to be -// exposed in the generated API. We could also investigate not generating the -// code, but using it through a package. We would have to investigate the impact -// on performance of making such change, though. For packages like unicode/norm, -// small changes like this could tank performance. - -import ( - "encoding/binary" - "fmt" - "hash/crc64" - "io" - "log" - "unicode/utf8" -) - -// builder builds a set of tries for associating values with runes. The set of -// tries can share common index and value blocks. -type builder struct { - Name string - - // ValueType is the type of the trie values looked up. - ValueType string - - // ValueSize is the byte size of the ValueType. - ValueSize int - - // IndexType is the type of trie index values used for all UTF-8 bytes of - // a rune except the last one. - IndexType string - - // IndexSize is the byte size of the IndexType. - IndexSize int - - // SourceType is used when generating the lookup functions. If the user - // requests StringSupport, all lookup functions will be generated for - // string input as well. - SourceType string - - Trie []*Trie - - IndexBlocks []*node - ValueBlocks [][]uint64 - Compactions []compaction - Checksum uint64 - - ASCIIBlock string - StarterBlock string - - indexBlockIdx map[uint64]int - valueBlockIdx map[uint64]nodeIndex - asciiBlockIdx map[uint64]int - - // Stats are used to fill out the template. - Stats struct { - NValueEntries int - NValueBytes int - NIndexEntries int - NIndexBytes int - NHandleBytes int - } - - err error -} - -// A nodeIndex encodes the index of a node, which is defined by the compaction -// which stores it and an index within the compaction. For internal nodes, the -// compaction is always 0. -type nodeIndex struct { - compaction int - index int -} - -// compaction keeps track of stats used for the compaction. -type compaction struct { - c Compacter - blocks []*node - maxHandle uint32 - totalSize int - - // Used by template-based generator and thus exported. - Cutoff uint32 - Offset uint32 - Handler string -} - -func (b *builder) setError(err error) { - if b.err == nil { - b.err = err - } -} - -// An Option can be passed to Gen. -type Option func(b *builder) error - -// Compact configures the trie generator to use the given Compacter. -func Compact(c Compacter) Option { - return func(b *builder) error { - b.Compactions = append(b.Compactions, compaction{ - c: c, - Handler: c.Handler() + "(n, b)"}) - return nil - } -} - -// Gen writes Go code for a shared trie lookup structure to w for the given -// Tries. The generated trie type will be called nameTrie. newNameTrie(x) will -// return the *nameTrie for tries[x]. A value can be looked up by using one of -// the various lookup methods defined on nameTrie. It returns the table size of -// the generated trie. -func Gen(w io.Writer, name string, tries []*Trie, opts ...Option) (sz int, err error) { - // The index contains two dummy blocks, followed by the zero block. The zero - // block is at offset 0x80, so that the offset for the zero block for - // continuation bytes is 0. - b := &builder{ - Name: name, - Trie: tries, - IndexBlocks: []*node{{}, {}, {}}, - Compactions: []compaction{{ - Handler: name + "Values[n<<6+uint32(b)]", - }}, - // The 0 key in indexBlockIdx and valueBlockIdx is the hash of the zero - // block. - indexBlockIdx: map[uint64]int{0: 0}, - valueBlockIdx: map[uint64]nodeIndex{0: {}}, - asciiBlockIdx: map[uint64]int{}, - } - b.Compactions[0].c = (*simpleCompacter)(b) - - for _, f := range opts { - if err := f(b); err != nil { - return 0, err - } - } - b.build() - if b.err != nil { - return 0, b.err - } - if err = b.print(w); err != nil { - return 0, err - } - return b.Size(), nil -} - -// A Trie represents a single root node of a trie. A builder may build several -// overlapping tries at once. -type Trie struct { - root *node - - hiddenTrie -} - -// hiddenTrie contains values we want to be visible to the template generator, -// but hidden from the API documentation. -type hiddenTrie struct { - Name string - Checksum uint64 - ASCIIIndex int - StarterIndex int -} - -// NewTrie returns a new trie root. -func NewTrie(name string) *Trie { - return &Trie{ - &node{ - children: make([]*node, blockSize), - values: make([]uint64, utf8.RuneSelf), - }, - hiddenTrie{Name: name}, - } -} - -// Gen is a convenience wrapper around the Gen func passing t as the only trie -// and uses the name passed to NewTrie. It returns the size of the generated -// tables. -func (t *Trie) Gen(w io.Writer, opts ...Option) (sz int, err error) { - return Gen(w, t.Name, []*Trie{t}, opts...) -} - -// node is a node of the intermediate trie structure. -type node struct { - // children holds this node's children. It is always of length 64. - // A child node may be nil. - children []*node - - // values contains the values of this node. If it is non-nil, this node is - // either a root or leaf node: - // For root nodes, len(values) == 128 and it maps the bytes in [0x00, 0x7F]. - // For leaf nodes, len(values) == 64 and it maps the bytes in [0x80, 0xBF]. - values []uint64 - - index nodeIndex -} - -// Insert associates value with the given rune. Insert will panic if a non-zero -// value is passed for an invalid rune. -func (t *Trie) Insert(r rune, value uint64) { - if value == 0 { - return - } - s := string(r) - if []rune(s)[0] != r && value != 0 { - // Note: The UCD tables will always assign what amounts to a zero value - // to a surrogate. Allowing a zero value for an illegal rune allows - // users to iterate over [0..MaxRune] without having to explicitly - // exclude surrogates, which would be tedious. - panic(fmt.Sprintf("triegen: non-zero value for invalid rune %U", r)) - } - if len(s) == 1 { - // It is a root node value (ASCII). - t.root.values[s[0]] = value - return - } - - n := t.root - for ; len(s) > 1; s = s[1:] { - if n.children == nil { - n.children = make([]*node, blockSize) - } - p := s[0] % blockSize - c := n.children[p] - if c == nil { - c = &node{} - n.children[p] = c - } - if len(s) > 2 && c.values != nil { - log.Fatalf("triegen: insert(%U): found internal node with values", r) - } - n = c - } - if n.values == nil { - n.values = make([]uint64, blockSize) - } - if n.children != nil { - log.Fatalf("triegen: insert(%U): found leaf node that also has child nodes", r) - } - n.values[s[0]-0x80] = value -} - -// Size returns the number of bytes the generated trie will take to store. It -// needs to be exported as it is used in the templates. -func (b *builder) Size() int { - // Index blocks. - sz := len(b.IndexBlocks) * blockSize * b.IndexSize - - // Skip the first compaction, which represents the normal value blocks, as - // its totalSize does not account for the ASCII blocks, which are managed - // separately. - sz += len(b.ValueBlocks) * blockSize * b.ValueSize - for _, c := range b.Compactions[1:] { - sz += c.totalSize - } - - // TODO: this computation does not account for the fixed overhead of a using - // a compaction, either code or data. As for data, though, the typical - // overhead of data is in the order of bytes (2 bytes for cases). Further, - // the savings of using a compaction should anyway be substantial for it to - // be worth it. - - // For multi-root tries, we also need to account for the handles. - if len(b.Trie) > 1 { - sz += 2 * b.IndexSize * len(b.Trie) - } - return sz -} - -func (b *builder) build() { - // Compute the sizes of the values. - var vmax uint64 - for _, t := range b.Trie { - vmax = maxValue(t.root, vmax) - } - b.ValueType, b.ValueSize = getIntType(vmax) - - // Compute all block allocations. - // TODO: first compute the ASCII blocks for all tries and then the other - // nodes. ASCII blocks are more restricted in placement, as they require two - // blocks to be placed consecutively. Processing them first may improve - // sharing (at least one zero block can be expected to be saved.) - for _, t := range b.Trie { - b.Checksum += b.buildTrie(t) - } - - // Compute the offsets for all the Compacters. - offset := uint32(0) - for i := range b.Compactions { - c := &b.Compactions[i] - c.Offset = offset - offset += c.maxHandle + 1 - c.Cutoff = offset - } - - // Compute the sizes of indexes. - // TODO: different byte positions could have different sizes. So far we have - // not found a case where this is beneficial. - imax := uint64(b.Compactions[len(b.Compactions)-1].Cutoff) - for _, ib := range b.IndexBlocks { - if x := uint64(ib.index.index); x > imax { - imax = x - } - } - b.IndexType, b.IndexSize = getIntType(imax) -} - -func maxValue(n *node, max uint64) uint64 { - if n == nil { - return max - } - for _, c := range n.children { - max = maxValue(c, max) - } - for _, v := range n.values { - if max < v { - max = v - } - } - return max -} - -func getIntType(v uint64) (string, int) { - switch { - case v < 1<<8: - return "uint8", 1 - case v < 1<<16: - return "uint16", 2 - case v < 1<<32: - return "uint32", 4 - } - return "uint64", 8 -} - -const ( - blockSize = 64 - - // Subtract two blocks to offset 0x80, the first continuation byte. - blockOffset = 2 - - // Subtract three blocks to offset 0xC0, the first non-ASCII starter. - rootBlockOffset = 3 -) - -var crcTable = crc64.MakeTable(crc64.ISO) - -func (b *builder) buildTrie(t *Trie) uint64 { - n := t.root - - // Get the ASCII offset. For the first trie, the ASCII block will be at - // position 0. - hasher := crc64.New(crcTable) - binary.Write(hasher, binary.BigEndian, n.values) - hash := hasher.Sum64() - - v, ok := b.asciiBlockIdx[hash] - if !ok { - v = len(b.ValueBlocks) - b.asciiBlockIdx[hash] = v - - b.ValueBlocks = append(b.ValueBlocks, n.values[:blockSize], n.values[blockSize:]) - if v == 0 { - // Add the zero block at position 2 so that it will be assigned a - // zero reference in the lookup blocks. - // TODO: always do this? This would allow us to remove a check from - // the trie lookup, but at the expense of extra space. Analyze - // performance for unicode/norm. - b.ValueBlocks = append(b.ValueBlocks, make([]uint64, blockSize)) - } - } - t.ASCIIIndex = v - - // Compute remaining offsets. - t.Checksum = b.computeOffsets(n, true) - // We already subtracted the normal blockOffset from the index. Subtract the - // difference for starter bytes. - t.StarterIndex = n.index.index - (rootBlockOffset - blockOffset) - return t.Checksum -} - -func (b *builder) computeOffsets(n *node, root bool) uint64 { - // For the first trie, the root lookup block will be at position 3, which is - // the offset for UTF-8 non-ASCII starter bytes. - first := len(b.IndexBlocks) == rootBlockOffset - if first { - b.IndexBlocks = append(b.IndexBlocks, n) - } - - // We special-case the cases where all values recursively are 0. This allows - // for the use of a zero block to which all such values can be directed. - hash := uint64(0) - if n.children != nil || n.values != nil { - hasher := crc64.New(crcTable) - for _, c := range n.children { - var v uint64 - if c != nil { - v = b.computeOffsets(c, false) - } - binary.Write(hasher, binary.BigEndian, v) - } - binary.Write(hasher, binary.BigEndian, n.values) - hash = hasher.Sum64() - } - - if first { - b.indexBlockIdx[hash] = rootBlockOffset - blockOffset - } - - // Compacters don't apply to internal nodes. - if n.children != nil { - v, ok := b.indexBlockIdx[hash] - if !ok { - v = len(b.IndexBlocks) - blockOffset - b.IndexBlocks = append(b.IndexBlocks, n) - b.indexBlockIdx[hash] = v - } - n.index = nodeIndex{0, v} - } else { - h, ok := b.valueBlockIdx[hash] - if !ok { - bestI, bestSize := 0, blockSize*b.ValueSize - for i, c := range b.Compactions[1:] { - if sz, ok := c.c.Size(n.values); ok && bestSize > sz { - bestI, bestSize = i+1, sz - } - } - c := &b.Compactions[bestI] - c.totalSize += bestSize - v := c.c.Store(n.values) - if c.maxHandle < v { - c.maxHandle = v - } - h = nodeIndex{bestI, int(v)} - b.valueBlockIdx[hash] = h - } - n.index = h - } - return hash -} diff --git a/vendor/golang.org/x/text/internal/ucd/LICENSE b/vendor/golang.org/x/text/internal/ucd/LICENSE deleted file mode 100644 index 6a66aea5..00000000 --- a/vendor/golang.org/x/text/internal/ucd/LICENSE +++ /dev/null @@ -1,27 +0,0 @@ -Copyright (c) 2009 The Go Authors. All rights reserved. - -Redistribution and use in source and binary forms, with or without -modification, are permitted provided that the following conditions are -met: - - * Redistributions of source code must retain the above copyright -notice, this list of conditions and the following disclaimer. - * Redistributions in binary form must reproduce the above -copyright notice, this list of conditions and the following disclaimer -in the documentation and/or other materials provided with the -distribution. - * Neither the name of Google Inc. nor the names of its -contributors may be used to endorse or promote products derived from -this software without specific prior written permission. - -THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS -"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT -LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR -A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT -OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, -SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT -LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, -DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY -THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT -(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE -OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/golang.org/x/text/internal/ucd/ucd.go b/vendor/golang.org/x/text/internal/ucd/ucd.go deleted file mode 100644 index 8c45b5f3..00000000 --- a/vendor/golang.org/x/text/internal/ucd/ucd.go +++ /dev/null @@ -1,371 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package ucd provides a parser for Unicode Character Database files, the -// format of which is defined in http://www.unicode.org/reports/tr44/. See -// http://www.unicode.org/Public/UCD/latest/ucd/ for example files. -// -// It currently does not support substitutions of missing fields. -package ucd // import "golang.org/x/text/internal/ucd" - -import ( - "bufio" - "errors" - "fmt" - "io" - "log" - "regexp" - "strconv" - "strings" -) - -// UnicodeData.txt fields. -const ( - CodePoint = iota - Name - GeneralCategory - CanonicalCombiningClass - BidiClass - DecompMapping - DecimalValue - DigitValue - NumericValue - BidiMirrored - Unicode1Name - ISOComment - SimpleUppercaseMapping - SimpleLowercaseMapping - SimpleTitlecaseMapping -) - -// Parse calls f for each entry in the given reader of a UCD file. It will close -// the reader upon return. It will call log.Fatal if any error occurred. -// -// This implements the most common usage pattern of using Parser. -func Parse(r io.ReadCloser, f func(p *Parser)) { - defer r.Close() - - p := New(r) - for p.Next() { - f(p) - } - if err := p.Err(); err != nil { - r.Close() // os.Exit will cause defers not to be called. - log.Fatal(err) - } -} - -// An Option is used to configure a Parser. -type Option func(p *Parser) - -func keepRanges(p *Parser) { - p.keepRanges = true -} - -var ( - // KeepRanges prevents the expansion of ranges. The raw ranges can be - // obtained by calling Range(0) on the parser. - KeepRanges Option = keepRanges -) - -// The Part option register a handler for lines starting with a '@'. The text -// after a '@' is available as the first field. Comments are handled as usual. -func Part(f func(p *Parser)) Option { - return func(p *Parser) { - p.partHandler = f - } -} - -// The CommentHandler option passes comments that are on a line by itself to -// a given handler. -func CommentHandler(f func(s string)) Option { - return func(p *Parser) { - p.commentHandler = f - } -} - -// A Parser parses Unicode Character Database (UCD) files. -type Parser struct { - scanner *bufio.Scanner - - keepRanges bool // Don't expand rune ranges in field 0. - - err error - comment string - field []string - // parsedRange is needed in case Range(0) is called more than once for one - // field. In some cases this requires scanning ahead. - line int - parsedRange bool - rangeStart, rangeEnd rune - - partHandler func(p *Parser) - commentHandler func(s string) -} - -func (p *Parser) setError(err error, msg string) { - if p.err == nil && err != nil { - if msg == "" { - p.err = fmt.Errorf("ucd:line:%d: %v", p.line, err) - } else { - p.err = fmt.Errorf("ucd:line:%d:%s: %v", p.line, msg, err) - } - } -} - -func (p *Parser) getField(i int) string { - if i >= len(p.field) { - return "" - } - return p.field[i] -} - -// Err returns a non-nil error if any error occurred during parsing. -func (p *Parser) Err() error { - return p.err -} - -// New returns a Parser for the given Reader. -func New(r io.Reader, o ...Option) *Parser { - p := &Parser{ - scanner: bufio.NewScanner(r), - } - for _, f := range o { - f(p) - } - return p -} - -// Next parses the next line in the file. It returns true if a line was parsed -// and false if it reached the end of the file. -func (p *Parser) Next() bool { - if !p.keepRanges && p.rangeStart < p.rangeEnd { - p.rangeStart++ - return true - } - p.comment = "" - p.field = p.field[:0] - p.parsedRange = false - - for p.scanner.Scan() && p.err == nil { - p.line++ - s := p.scanner.Text() - if s == "" { - continue - } - if s[0] == '#' { - if p.commentHandler != nil { - p.commentHandler(strings.TrimSpace(s[1:])) - } - continue - } - - // Parse line - if i := strings.IndexByte(s, '#'); i != -1 { - p.comment = strings.TrimSpace(s[i+1:]) - s = s[:i] - } - if s[0] == '@' { - if p.partHandler != nil { - p.field = append(p.field, strings.TrimSpace(s[1:])) - p.partHandler(p) - p.field = p.field[:0] - } - p.comment = "" - continue - } - for { - i := strings.IndexByte(s, ';') - if i == -1 { - p.field = append(p.field, strings.TrimSpace(s)) - break - } - p.field = append(p.field, strings.TrimSpace(s[:i])) - s = s[i+1:] - } - if !p.keepRanges { - p.rangeStart, p.rangeEnd = p.getRange(0) - } - return true - } - p.setError(p.scanner.Err(), "scanner failed") - return false -} - -func parseRune(b string) (rune, error) { - if len(b) > 2 && b[0] == 'U' && b[1] == '+' { - b = b[2:] - } - x, err := strconv.ParseUint(b, 16, 32) - return rune(x), err -} - -func (p *Parser) parseRune(s string) rune { - x, err := parseRune(s) - p.setError(err, "failed to parse rune") - return x -} - -// Rune parses and returns field i as a rune. -func (p *Parser) Rune(i int) rune { - if i > 0 || p.keepRanges { - return p.parseRune(p.getField(i)) - } - return p.rangeStart -} - -// Runes interprets and returns field i as a sequence of runes. -func (p *Parser) Runes(i int) (runes []rune) { - add := func(s string) { - if s = strings.TrimSpace(s); len(s) > 0 { - runes = append(runes, p.parseRune(s)) - } - } - for b := p.getField(i); ; { - i := strings.IndexByte(b, ' ') - if i == -1 { - add(b) - break - } - add(b[:i]) - b = b[i+1:] - } - return -} - -var ( - errIncorrectLegacyRange = errors.New("ucd: unmatched <* First>") - - // reRange matches one line of a legacy rune range. - reRange = regexp.MustCompile("^([0-9A-F]*);<([^,]*), ([^>]*)>(.*)$") -) - -// Range parses and returns field i as a rune range. A range is inclusive at -// both ends. If the field only has one rune, first and last will be identical. -// It supports the legacy format for ranges used in UnicodeData.txt. -func (p *Parser) Range(i int) (first, last rune) { - if !p.keepRanges { - return p.rangeStart, p.rangeStart - } - return p.getRange(i) -} - -func (p *Parser) getRange(i int) (first, last rune) { - b := p.getField(i) - if k := strings.Index(b, ".."); k != -1 { - return p.parseRune(b[:k]), p.parseRune(b[k+2:]) - } - // The first field may not be a rune, in which case we may ignore any error - // and set the range as 0..0. - x, err := parseRune(b) - if err != nil { - // Disable range parsing henceforth. This ensures that an error will be - // returned if the user subsequently will try to parse this field as - // a Rune. - p.keepRanges = true - } - // Special case for UnicodeData that was retained for backwards compatibility. - if i == 0 && len(p.field) > 1 && strings.HasSuffix(p.field[1], "First>") { - if p.parsedRange { - return p.rangeStart, p.rangeEnd - } - mf := reRange.FindStringSubmatch(p.scanner.Text()) - p.line++ - if mf == nil || !p.scanner.Scan() { - p.setError(errIncorrectLegacyRange, "") - return x, x - } - // Using Bytes would be more efficient here, but Text is a lot easier - // and this is not a frequent case. - ml := reRange.FindStringSubmatch(p.scanner.Text()) - if ml == nil || mf[2] != ml[2] || ml[3] != "Last" || mf[4] != ml[4] { - p.setError(errIncorrectLegacyRange, "") - return x, x - } - p.rangeStart, p.rangeEnd = x, p.parseRune(p.scanner.Text()[:len(ml[1])]) - p.parsedRange = true - return p.rangeStart, p.rangeEnd - } - return x, x -} - -// bools recognizes all valid UCD boolean values. -var bools = map[string]bool{ - "": false, - "N": false, - "No": false, - "F": false, - "False": false, - "Y": true, - "Yes": true, - "T": true, - "True": true, -} - -// Bool parses and returns field i as a boolean value. -func (p *Parser) Bool(i int) bool { - f := p.getField(i) - for s, v := range bools { - if f == s { - return v - } - } - p.setError(strconv.ErrSyntax, "error parsing bool") - return false -} - -// Int parses and returns field i as an integer value. -func (p *Parser) Int(i int) int { - x, err := strconv.ParseInt(string(p.getField(i)), 10, 64) - p.setError(err, "error parsing int") - return int(x) -} - -// Uint parses and returns field i as an unsigned integer value. -func (p *Parser) Uint(i int) uint { - x, err := strconv.ParseUint(string(p.getField(i)), 10, 64) - p.setError(err, "error parsing uint") - return uint(x) -} - -// Float parses and returns field i as a decimal value. -func (p *Parser) Float(i int) float64 { - x, err := strconv.ParseFloat(string(p.getField(i)), 64) - p.setError(err, "error parsing float") - return x -} - -// String parses and returns field i as a string value. -func (p *Parser) String(i int) string { - return string(p.getField(i)) -} - -// Strings parses and returns field i as a space-separated list of strings. -func (p *Parser) Strings(i int) []string { - ss := strings.Split(string(p.getField(i)), " ") - for i, s := range ss { - ss[i] = strings.TrimSpace(s) - } - return ss -} - -// Comment returns the comments for the current line. -func (p *Parser) Comment() string { - return string(p.comment) -} - -var errUndefinedEnum = errors.New("ucd: undefined enum value") - -// Enum interprets and returns field i as a value that must be one of the values -// in enum. -func (p *Parser) Enum(i int, enum ...string) string { - f := p.getField(i) - for _, s := range enum { - if f == s { - return s - } - } - p.setError(errUndefinedEnum, "error parsing enum") - return "" -} diff --git a/vendor/golang.org/x/text/internal/utf8internal/LICENSE b/vendor/golang.org/x/text/internal/utf8internal/LICENSE deleted file mode 100644 index 6a66aea5..00000000 --- a/vendor/golang.org/x/text/internal/utf8internal/LICENSE +++ /dev/null @@ -1,27 +0,0 @@ -Copyright (c) 2009 The Go Authors. All rights reserved. - -Redistribution and use in source and binary forms, with or without -modification, are permitted provided that the following conditions are -met: - - * Redistributions of source code must retain the above copyright -notice, this list of conditions and the following disclaimer. - * Redistributions in binary form must reproduce the above -copyright notice, this list of conditions and the following disclaimer -in the documentation and/or other materials provided with the -distribution. - * Neither the name of Google Inc. nor the names of its -contributors may be used to endorse or promote products derived from -this software without specific prior written permission. - -THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS -"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT -LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR -A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT -OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, -SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT -LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, -DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY -THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT -(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE -OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/golang.org/x/text/internal/utf8internal/utf8internal.go b/vendor/golang.org/x/text/internal/utf8internal/utf8internal.go deleted file mode 100644 index 575cea87..00000000 --- a/vendor/golang.org/x/text/internal/utf8internal/utf8internal.go +++ /dev/null @@ -1,87 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package utf8internal contains low-level utf8-related constants, tables, etc. -// that are used internally by the text package. -package utf8internal - -// The default lowest and highest continuation byte. -const ( - LoCB = 0x80 // 1000 0000 - HiCB = 0xBF // 1011 1111 -) - -// Constants related to getting information of first bytes of UTF-8 sequences. -const ( - // ASCII identifies a UTF-8 byte as ASCII. - ASCII = as - - // FirstInvalid indicates a byte is invalid as a first byte of a UTF-8 - // sequence. - FirstInvalid = xx - - // SizeMask is a mask for the size bits. Use use x&SizeMask to get the size. - SizeMask = 7 - - // AcceptShift is the right-shift count for the first byte info byte to get - // the index into the AcceptRanges table. See AcceptRanges. - AcceptShift = 4 - - // The names of these constants are chosen to give nice alignment in the - // table below. The first nibble is an index into acceptRanges or F for - // special one-byte cases. The second nibble is the Rune length or the - // Status for the special one-byte case. - xx = 0xF1 // invalid: size 1 - as = 0xF0 // ASCII: size 1 - s1 = 0x02 // accept 0, size 2 - s2 = 0x13 // accept 1, size 3 - s3 = 0x03 // accept 0, size 3 - s4 = 0x23 // accept 2, size 3 - s5 = 0x34 // accept 3, size 4 - s6 = 0x04 // accept 0, size 4 - s7 = 0x44 // accept 4, size 4 -) - -// First is information about the first byte in a UTF-8 sequence. -var First = [256]uint8{ - // 1 2 3 4 5 6 7 8 9 A B C D E F - as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x00-0x0F - as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x10-0x1F - as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x20-0x2F - as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x30-0x3F - as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x40-0x4F - as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x50-0x5F - as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x60-0x6F - as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x70-0x7F - // 1 2 3 4 5 6 7 8 9 A B C D E F - xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, // 0x80-0x8F - xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, // 0x90-0x9F - xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, // 0xA0-0xAF - xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, // 0xB0-0xBF - xx, xx, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, // 0xC0-0xCF - s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, // 0xD0-0xDF - s2, s3, s3, s3, s3, s3, s3, s3, s3, s3, s3, s3, s3, s4, s3, s3, // 0xE0-0xEF - s5, s6, s6, s6, s7, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, // 0xF0-0xFF -} - -// AcceptRange gives the range of valid values for the second byte in a UTF-8 -// sequence for any value for First that is not ASCII or FirstInvalid. -type AcceptRange struct { - Lo uint8 // lowest value for second byte. - Hi uint8 // highest value for second byte. -} - -// AcceptRanges is a slice of AcceptRange values. For a given byte sequence b -// -// AcceptRanges[First[b[0]]>>AcceptShift] -// -// will give the value of AcceptRange for the multi-byte UTF-8 sequence starting -// at b[0]. -var AcceptRanges = [...]AcceptRange{ - 0: {LoCB, HiCB}, - 1: {0xA0, HiCB}, - 2: {LoCB, 0x9F}, - 3: {0x90, HiCB}, - 4: {LoCB, 0x8F}, -} |