summaryrefslogtreecommitdiffstats
path: root/vendor/golang.org/x
diff options
context:
space:
mode:
authorWim <wim@42.be>2020-08-10 00:29:54 +0200
committerGitHub <noreply@github.com>2020-08-10 00:29:54 +0200
commit4e50fd864921c556988c919269448efdb90fa961 (patch)
treea3625f03f8de3c4f3841364000a4ea3aa42c1533 /vendor/golang.org/x
parentdfdffa0027334e55ce213fc6eb62206dbf48baf6 (diff)
downloadmatterbridge-msglm-4e50fd864921c556988c919269448efdb90fa961.tar.gz
matterbridge-msglm-4e50fd864921c556988c919269448efdb90fa961.tar.bz2
matterbridge-msglm-4e50fd864921c556988c919269448efdb90fa961.zip
Use mattermost v5 module (#1192)
Diffstat (limited to 'vendor/golang.org/x')
-rw-r--r--vendor/golang.org/x/net/http2/client_conn_pool.go8
-rw-r--r--vendor/golang.org/x/net/http2/flow.go2
-rw-r--r--vendor/golang.org/x/net/http2/hpack/huffman.go7
-rw-r--r--vendor/golang.org/x/net/http2/http2.go7
-rw-r--r--vendor/golang.org/x/net/http2/server.go6
-rw-r--r--vendor/golang.org/x/net/http2/transport.go12
-rw-r--r--vendor/golang.org/x/text/internal/language/common.go16
-rw-r--r--vendor/golang.org/x/text/internal/language/compact.go29
-rw-r--r--vendor/golang.org/x/text/internal/language/compact/compact.go61
-rw-r--r--vendor/golang.org/x/text/internal/language/compact/language.go260
-rw-r--r--vendor/golang.org/x/text/internal/language/compact/parents.go120
-rw-r--r--vendor/golang.org/x/text/internal/language/compact/tables.go1015
-rw-r--r--vendor/golang.org/x/text/internal/language/compact/tags.go91
-rw-r--r--vendor/golang.org/x/text/internal/language/compose.go167
-rw-r--r--vendor/golang.org/x/text/internal/language/coverage.go28
-rw-r--r--vendor/golang.org/x/text/internal/language/language.go596
-rw-r--r--vendor/golang.org/x/text/internal/language/lookup.go412
-rw-r--r--vendor/golang.org/x/text/internal/language/match.go226
-rw-r--r--vendor/golang.org/x/text/internal/language/parse.go594
-rw-r--r--vendor/golang.org/x/text/internal/language/tables.go3431
-rw-r--r--vendor/golang.org/x/text/internal/language/tags.go48
-rw-r--r--vendor/golang.org/x/text/internal/tag/tag.go100
-rw-r--r--vendor/golang.org/x/text/language/coverage.go187
-rw-r--r--vendor/golang.org/x/text/language/doc.go102
-rw-r--r--vendor/golang.org/x/text/language/go1_1.go38
-rw-r--r--vendor/golang.org/x/text/language/go1_2.go11
-rw-r--r--vendor/golang.org/x/text/language/language.go601
-rw-r--r--vendor/golang.org/x/text/language/match.go735
-rw-r--r--vendor/golang.org/x/text/language/parse.go228
-rw-r--r--vendor/golang.org/x/text/language/tables.go298
-rw-r--r--vendor/golang.org/x/text/language/tags.go145
31 files changed, 9565 insertions, 16 deletions
diff --git a/vendor/golang.org/x/net/http2/client_conn_pool.go b/vendor/golang.org/x/net/http2/client_conn_pool.go
index f4d9b5ec..3a67636f 100644
--- a/vendor/golang.org/x/net/http2/client_conn_pool.go
+++ b/vendor/golang.org/x/net/http2/client_conn_pool.go
@@ -107,6 +107,7 @@ func (p *clientConnPool) getClientConn(req *http.Request, addr string, dialOnMis
// dialCall is an in-flight Transport dial call to a host.
type dialCall struct {
+ _ incomparable
p *clientConnPool
done chan struct{} // closed when done
res *ClientConn // valid after done is closed
@@ -180,6 +181,7 @@ func (p *clientConnPool) addConnIfNeeded(key string, t *Transport, c *tls.Conn)
}
type addConnCall struct {
+ _ incomparable
p *clientConnPool
done chan struct{} // closed when done
err error
@@ -200,12 +202,6 @@ func (c *addConnCall) run(t *Transport, key string, tc *tls.Conn) {
close(c.done)
}
-func (p *clientConnPool) addConn(key string, cc *ClientConn) {
- p.mu.Lock()
- p.addConnLocked(key, cc)
- p.mu.Unlock()
-}
-
// p.mu must be held
func (p *clientConnPool) addConnLocked(key string, cc *ClientConn) {
for _, v := range p.conns[key] {
diff --git a/vendor/golang.org/x/net/http2/flow.go b/vendor/golang.org/x/net/http2/flow.go
index cea601fc..b51f0e0c 100644
--- a/vendor/golang.org/x/net/http2/flow.go
+++ b/vendor/golang.org/x/net/http2/flow.go
@@ -8,6 +8,8 @@ package http2
// flow is the flow control window's size.
type flow struct {
+ _ incomparable
+
// n is the number of DATA bytes we're allowed to send.
// A flow is kept both on a conn and a per-stream.
n int32
diff --git a/vendor/golang.org/x/net/http2/hpack/huffman.go b/vendor/golang.org/x/net/http2/hpack/huffman.go
index b412a96c..a1ab2f05 100644
--- a/vendor/golang.org/x/net/http2/hpack/huffman.go
+++ b/vendor/golang.org/x/net/http2/hpack/huffman.go
@@ -105,7 +105,14 @@ func huffmanDecode(buf *bytes.Buffer, maxLen int, v []byte) error {
return nil
}
+// incomparable is a zero-width, non-comparable type. Adding it to a struct
+// makes that struct also non-comparable, and generally doesn't add
+// any size (as long as it's first).
+type incomparable [0]func()
+
type node struct {
+ _ incomparable
+
// children is non-nil for internal nodes
children *[256]*node
diff --git a/vendor/golang.org/x/net/http2/http2.go b/vendor/golang.org/x/net/http2/http2.go
index 27cc893c..5571ccfd 100644
--- a/vendor/golang.org/x/net/http2/http2.go
+++ b/vendor/golang.org/x/net/http2/http2.go
@@ -241,6 +241,7 @@ func (cw closeWaiter) Wait() {
// Its buffered writer is lazily allocated as needed, to minimize
// idle memory usage with many connections.
type bufferedWriter struct {
+ _ incomparable
w io.Writer // immutable
bw *bufio.Writer // non-nil when data is buffered
}
@@ -313,6 +314,7 @@ func bodyAllowedForStatus(status int) bool {
}
type httpError struct {
+ _ incomparable
msg string
timeout bool
}
@@ -376,3 +378,8 @@ func (s *sorter) SortStrings(ss []string) {
func validPseudoPath(v string) bool {
return (len(v) > 0 && v[0] == '/') || v == "*"
}
+
+// incomparable is a zero-width, non-comparable type. Adding it to a struct
+// makes that struct also non-comparable, and generally doesn't add
+// any size (as long as it's first).
+type incomparable [0]func()
diff --git a/vendor/golang.org/x/net/http2/server.go b/vendor/golang.org/x/net/http2/server.go
index bc9e41a1..69e1a776 100644
--- a/vendor/golang.org/x/net/http2/server.go
+++ b/vendor/golang.org/x/net/http2/server.go
@@ -761,6 +761,7 @@ func (sc *serverConn) readFrames() {
// frameWriteResult is the message passed from writeFrameAsync to the serve goroutine.
type frameWriteResult struct {
+ _ incomparable
wr FrameWriteRequest // what was written (or attempted)
err error // result of the writeFrame call
}
@@ -771,7 +772,7 @@ type frameWriteResult struct {
// serverConn.
func (sc *serverConn) writeFrameAsync(wr FrameWriteRequest) {
err := wr.write.writeFrame(sc)
- sc.wroteFrameCh <- frameWriteResult{wr, err}
+ sc.wroteFrameCh <- frameWriteResult{wr: wr, err: err}
}
func (sc *serverConn) closeAllStreamsOnConnClose() {
@@ -1161,7 +1162,7 @@ func (sc *serverConn) startFrameWrite(wr FrameWriteRequest) {
if wr.write.staysWithinBuffer(sc.bw.Available()) {
sc.writingFrameAsync = false
err := wr.write.writeFrame(sc)
- sc.wroteFrame(frameWriteResult{wr, err})
+ sc.wroteFrame(frameWriteResult{wr: wr, err: err})
} else {
sc.writingFrameAsync = true
go sc.writeFrameAsync(wr)
@@ -2275,6 +2276,7 @@ func (sc *serverConn) sendWindowUpdate32(st *stream, n int32) {
// requestBody is the Handler's Request.Body type.
// Read and Close may be called concurrently.
type requestBody struct {
+ _ incomparable
stream *stream
conn *serverConn
closed bool // for use by Close only
diff --git a/vendor/golang.org/x/net/http2/transport.go b/vendor/golang.org/x/net/http2/transport.go
index e4fb0253..54acc1e3 100644
--- a/vendor/golang.org/x/net/http2/transport.go
+++ b/vendor/golang.org/x/net/http2/transport.go
@@ -916,7 +916,7 @@ func commaSeparatedTrailers(req *http.Request) (string, error) {
k = http.CanonicalHeaderKey(k)
switch k {
case "Transfer-Encoding", "Trailer", "Content-Length":
- return "", &badStringError{"invalid Trailer key", k}
+ return "", fmt.Errorf("invalid Trailer key %q", k)
}
keys = append(keys, k)
}
@@ -1394,13 +1394,6 @@ func (cs *clientStream) awaitFlowControl(maxBytes int) (taken int32, err error)
}
}
-type badStringError struct {
- what string
- str string
-}
-
-func (e *badStringError) Error() string { return fmt.Sprintf("%s %q", e.what, e.str) }
-
// requires cc.mu be held.
func (cc *ClientConn) encodeHeaders(req *http.Request, addGzipHeader bool, trailers string, contentLength int64) ([]byte, error) {
cc.hbuf.Reset()
@@ -1616,6 +1609,7 @@ func (cc *ClientConn) writeHeader(name, value string) {
}
type resAndError struct {
+ _ incomparable
res *http.Response
err error
}
@@ -1663,6 +1657,7 @@ func (cc *ClientConn) streamByID(id uint32, andRemove bool) *clientStream {
// clientConnReadLoop is the state owned by the clientConn's frame-reading readLoop.
type clientConnReadLoop struct {
+ _ incomparable
cc *ClientConn
closeWhenIdle bool
}
@@ -2479,6 +2474,7 @@ func (rt erringRoundTripper) RoundTrip(*http.Request) (*http.Response, error) {
// gzipReader wraps a response body so it can lazily
// call gzip.NewReader on the first call to Read
type gzipReader struct {
+ _ incomparable
body io.ReadCloser // underlying Response.Body
zr *gzip.Reader // lazily-initialized gzip reader
zerr error // sticky error
diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go
new file mode 100644
index 00000000..cdfdb749
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/common.go
@@ -0,0 +1,16 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+// This file contains code common to the maketables.go and the package code.
+
+// AliasType is the type of an alias in AliasMap.
+type AliasType int8
+
+const (
+ Deprecated AliasType = iota
+ Macro
+ Legacy
+
+ AliasTypeUnknown AliasType = -1
+)
diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go
new file mode 100644
index 00000000..46a00150
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact.go
@@ -0,0 +1,29 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// CompactCoreInfo is a compact integer with the three core tags encoded.
+type CompactCoreInfo uint32
+
+// GetCompactCore generates a uint32 value that is guaranteed to be unique for
+// different language, region, and script values.
+func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) {
+ if t.LangID > langNoIndexOffset {
+ return 0, false
+ }
+ cci |= CompactCoreInfo(t.LangID) << (8 + 12)
+ cci |= CompactCoreInfo(t.ScriptID) << 12
+ cci |= CompactCoreInfo(t.RegionID)
+ return cci, true
+}
+
+// Tag generates a tag from c.
+func (c CompactCoreInfo) Tag() Tag {
+ return Tag{
+ LangID: Language(c >> 20),
+ RegionID: Region(c & 0x3ff),
+ ScriptID: Script(c>>12) & 0xff,
+ }
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go
new file mode 100644
index 00000000..1b36935e
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/compact.go
@@ -0,0 +1,61 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package compact defines a compact representation of language tags.
+//
+// Common language tags (at least all for which locale information is defined
+// in CLDR) are assigned a unique index. Each Tag is associated with such an
+// ID for selecting language-related resources (such as translations) as well
+// as one for selecting regional defaults (currency, number formatting, etc.)
+//
+// It may want to export this functionality at some point, but at this point
+// this is only available for use within x/text.
+package compact // import "golang.org/x/text/internal/language/compact"
+
+import (
+ "sort"
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// ID is an integer identifying a single tag.
+type ID uint16
+
+func getCoreIndex(t language.Tag) (id ID, ok bool) {
+ cci, ok := language.GetCompactCore(t)
+ if !ok {
+ return 0, false
+ }
+ i := sort.Search(len(coreTags), func(i int) bool {
+ return cci <= coreTags[i]
+ })
+ if i == len(coreTags) || coreTags[i] != cci {
+ return 0, false
+ }
+ return ID(i), true
+}
+
+// Parent returns the ID of the parent or the root ID if id is already the root.
+func (id ID) Parent() ID {
+ return parents[id]
+}
+
+// Tag converts id to an internal language Tag.
+func (id ID) Tag() language.Tag {
+ if int(id) >= len(coreTags) {
+ return specialTags[int(id)-len(coreTags)]
+ }
+ return coreTags[id].Tag()
+}
+
+var specialTags []language.Tag
+
+func init() {
+ tags := strings.Split(specialTagsStr, " ")
+ specialTags = make([]language.Tag, len(tags))
+ for i, t := range tags {
+ specialTags[i] = language.MustParse(t)
+ }
+}
diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go
new file mode 100644
index 00000000..83816a72
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/language.go
@@ -0,0 +1,260 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_index.go -output tables.go
+//go:generate go run gen_parents.go
+
+package compact
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed.
+type Tag struct {
+ // NOTE: exported tags will become part of the public API.
+ language ID
+ locale ID
+ full fullTag // always a language.Tag for now.
+}
+
+const _und = 0
+
+type fullTag interface {
+ IsRoot() bool
+ Parent() language.Tag
+}
+
+// Make a compact Tag from a fully specified internal language Tag.
+func Make(t language.Tag) (tag Tag) {
+ if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" {
+ if r, err := language.ParseRegion(region[:2]); err == nil {
+ tFull := t
+ t, _ = t.SetTypeForKey("rg", "")
+ // TODO: should we not consider "va" for the language tag?
+ var exact1, exact2 bool
+ tag.language, exact1 = FromTag(t)
+ t.RegionID = r
+ tag.locale, exact2 = FromTag(t)
+ if !exact1 || !exact2 {
+ tag.full = tFull
+ }
+ return tag
+ }
+ }
+ lang, ok := FromTag(t)
+ tag.language = lang
+ tag.locale = lang
+ if !ok {
+ tag.full = t
+ }
+ return tag
+}
+
+// Tag returns an internal language Tag version of this tag.
+func (t Tag) Tag() language.Tag {
+ if t.full != nil {
+ return t.full.(language.Tag)
+ }
+ tag := t.language.Tag()
+ if t.language != t.locale {
+ loc := t.locale.Tag()
+ tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz")
+ }
+ return tag
+}
+
+// IsCompact reports whether this tag is fully defined in terms of ID.
+func (t *Tag) IsCompact() bool {
+ return t.full == nil
+}
+
+// MayHaveVariants reports whether a tag may have variants. If it returns false
+// it is guaranteed the tag does not have variants.
+func (t Tag) MayHaveVariants() bool {
+ return t.full != nil || int(t.language) >= len(coreTags)
+}
+
+// MayHaveExtensions reports whether a tag may have extensions. If it returns
+// false it is guaranteed the tag does not have them.
+func (t Tag) MayHaveExtensions() bool {
+ return t.full != nil ||
+ int(t.language) >= len(coreTags) ||
+ t.language != t.locale
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+ if t.full != nil {
+ return t.full.IsRoot()
+ }
+ return t.language == _und
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+ if t.full != nil {
+ return Make(t.full.Parent())
+ }
+ if t.language != t.locale {
+ // Simulate stripping -u-rg-xxxxxx
+ return Tag{language: t.language, locale: t.language}
+ }
+ // TODO: use parent lookup table once cycle from internal package is
+ // removed. Probably by internalizing the table and declaring this fast
+ // enough.
+ // lang := compactID(internal.Parent(uint16(t.language)))
+ lang, _ := FromTag(t.language.Tag().Parent())
+ return Tag{language: lang, locale: lang}
+}
+
+// returns token t and the rest of the string.
+func nextToken(s string) (t, tail string) {
+ p := strings.Index(s[1:], "-")
+ if p == -1 {
+ return s[1:], ""
+ }
+ p++
+ return s[1:p], s[p:]
+}
+
+// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags
+// for which data exists in the text repository.The index will change over time
+// and should not be stored in persistent storage. If t does not match a compact
+// index, exact will be false and the compact index will be returned for the
+// first match after repeatedly taking the Parent of t.
+func LanguageID(t Tag) (id ID, exact bool) {
+ return t.language, t.full == nil
+}
+
+// RegionalID returns the ID for the regional variant of this tag. This index is
+// used to indicate region-specific overrides, such as default currency, default
+// calendar and week data, default time cycle, and default measurement system
+// and unit preferences.
+//
+// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US
+// settings for currency, number formatting, etc. The CompactIndex for this tag
+// will be that for en-GB, while the RegionalID will be the one corresponding to
+// en-US.
+func RegionalID(t Tag) (id ID, exact bool) {
+ return t.locale, t.full == nil
+}
+
+// LanguageTag returns t stripped of regional variant indicators.
+//
+// At the moment this means it is stripped of a regional and variant subtag "rg"
+// and "va" in the "u" extension.
+func (t Tag) LanguageTag() Tag {
+ if t.full == nil {
+ return Tag{language: t.language, locale: t.language}
+ }
+ tt := t.Tag()
+ tt.SetTypeForKey("rg", "")
+ tt.SetTypeForKey("va", "")
+ return Make(tt)
+}
+
+// RegionalTag returns the regional variant of the tag.
+//
+// At the moment this means that the region is set from the regional subtag
+// "rg" in the "u" extension.
+func (t Tag) RegionalTag() Tag {
+ rt := Tag{language: t.locale, locale: t.locale}
+ if t.full == nil {
+ return rt
+ }
+ b := language.Builder{}
+ tag := t.Tag()
+ // tag, _ = tag.SetTypeForKey("rg", "")
+ b.SetTag(t.locale.Tag())
+ if v := tag.Variants(); v != "" {
+ for _, v := range strings.Split(v, "-") {
+ b.AddVariant(v)
+ }
+ }
+ for _, e := range tag.Extensions() {
+ b.AddExt(e)
+ }
+ return t
+}
+
+// FromTag reports closest matching ID for an internal language Tag.
+func FromTag(t language.Tag) (id ID, exact bool) {
+ // TODO: perhaps give more frequent tags a lower index.
+ // TODO: we could make the indexes stable. This will excluded some
+ // possibilities for optimization, so don't do this quite yet.
+ exact = true
+
+ b, s, r := t.Raw()
+ if t.HasString() {
+ if t.IsPrivateUse() {
+ // We have no entries for user-defined tags.
+ return 0, false
+ }
+ hasExtra := false
+ if t.HasVariants() {
+ if t.HasExtensions() {
+ build := language.Builder{}
+ build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r})
+ build.AddVariant(t.Variants())
+ exact = false
+ t = build.Make()
+ }
+ hasExtra = true
+ } else if _, ok := t.Extension('u'); ok {
+ // TODO: va may mean something else. Consider not considering it.
+ // Strip all but the 'va' entry.
+ old := t
+ variant := t.TypeForKey("va")
+ t = language.Tag{LangID: b, ScriptID: s, RegionID: r}
+ if variant != "" {
+ t, _ = t.SetTypeForKey("va", variant)
+ hasExtra = true
+ }
+ exact = old == t
+ } else {
+ exact = false
+ }
+ if hasExtra {
+ // We have some variants.
+ for i, s := range specialTags {
+ if s == t {
+ return ID(i + len(coreTags)), exact
+ }
+ }
+ exact = false
+ }
+ }
+ if x, ok := getCoreIndex(t); ok {
+ return x, exact
+ }
+ exact = false
+ if r != 0 && s == 0 {
+ // Deal with cases where an extra script is inserted for the region.
+ t, _ := t.Maximize()
+ if x, ok := getCoreIndex(t); ok {
+ return x, exact
+ }
+ }
+ for t = t.Parent(); t != root; t = t.Parent() {
+ // No variants specified: just compare core components.
+ // The key has the form lllssrrr, where l, s, and r are nibbles for
+ // respectively the langID, scriptID, and regionID.
+ if x, ok := getCoreIndex(t); ok {
+ return x, exact
+ }
+ }
+ return 0, exact
+}
+
+var root = language.Tag{}
diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go
new file mode 100644
index 00000000..8d810723
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/parents.go
@@ -0,0 +1,120 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+// parents maps a compact index of a tag to the compact index of the parent of
+// this tag.
+var parents = []ID{ // 775 elements
+ // Entry 0 - 3F
+ 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006,
+ 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+ 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+ 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
+ 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000,
+ 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000,
+ 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000,
+ 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e,
+ // Entry 40 - 7F
+ 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046,
+ 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000,
+ 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000,
+ 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d,
+ 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066,
+ 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b,
+ 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000,
+ 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e,
+ // Entry 80 - BF
+ 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086,
+ 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087,
+ 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087,
+ 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086,
+ // Entry C0 - FF
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087,
+ 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
+ 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087,
+ 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000,
+ 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2,
+ 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1,
+ // Entry 100 - 13F
+ 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1,
+ 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e,
+ 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000,
+ 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e,
+ 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ // Entry 140 - 17F
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
+ 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156,
+ 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c,
+ 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000,
+ 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000,
+ 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176,
+ 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e,
+ // Entry 180 - 1BF
+ 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184,
+ 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e,
+ 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000,
+ 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000,
+ 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000,
+ 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000,
+ 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6,
+ 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000,
+ // Entry 1C0 - 1FF
+ 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000,
+ 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb,
+ 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000,
+ 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000,
+ 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6,
+ 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee,
+ 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5,
+ 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000,
+ // Entry 200 - 23F
+ 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000,
+ 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000,
+ 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000,
+ 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000,
+ 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226,
+ 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000,
+ 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236,
+ 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244,
+ // Entry 240 - 27F
+ 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000,
+ 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000,
+ 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254,
+ 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000,
+ 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000,
+ 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e,
+ 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273,
+ 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000,
+ // Entry 280 - 2BF
+ 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286,
+ 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000,
+ 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295,
+ 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d,
+ 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000,
+ 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae,
+ 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5,
+ 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000,
+ // Entry 2C0 - 2FF
+ 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000,
+ 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd,
+ 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000,
+ 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000,
+ 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6,
+ 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000,
+ 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000,
+ 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000,
+ // Entry 300 - 33F
+ 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6,
+} // Size: 1574 bytes
+
+// Total table size 1574 bytes (1KiB); checksum: 895AAF0B
diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go
new file mode 100644
index 00000000..554ca354
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/tables.go
@@ -0,0 +1,1015 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package compact
+
+import "golang.org/x/text/internal/language"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+// NumCompactTags is the number of common tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = 775
+const (
+ undIndex ID = 0
+ afIndex ID = 1
+ afNAIndex ID = 2
+ afZAIndex ID = 3
+ agqIndex ID = 4
+ agqCMIndex ID = 5
+ akIndex ID = 6
+ akGHIndex ID = 7
+ amIndex ID = 8
+ amETIndex ID = 9
+ arIndex ID = 10
+ ar001Index ID = 11
+ arAEIndex ID = 12
+ arBHIndex ID = 13
+ arDJIndex ID = 14
+ arDZIndex ID = 15
+ arEGIndex ID = 16
+ arEHIndex ID = 17
+ arERIndex ID = 18
+ arILIndex ID = 19
+ arIQIndex ID = 20
+ arJOIndex ID = 21
+ arKMIndex ID = 22
+ arKWIndex ID = 23
+ arLBIndex ID = 24
+ arLYIndex ID = 25
+ arMAIndex ID = 26
+ arMRIndex ID = 27
+ arOMIndex ID = 28
+ arPSIndex ID = 29
+ arQAIndex ID = 30
+ arSAIndex ID = 31
+ arSDIndex ID = 32
+ arSOIndex ID = 33
+ arSSIndex ID = 34
+ arSYIndex ID = 35
+ arTDIndex ID = 36
+ arTNIndex ID = 37
+ arYEIndex ID = 38
+ arsIndex ID = 39
+ asIndex ID = 40
+ asINIndex ID = 41
+ asaIndex ID = 42
+ asaTZIndex ID = 43
+ astIndex ID = 44
+ astESIndex ID = 45
+ azIndex ID = 46
+ azCyrlIndex ID = 47
+ azCyrlAZIndex ID = 48
+ azLatnIndex ID = 49
+ azLatnAZIndex ID = 50
+ basIndex ID = 51
+ basCMIndex ID = 52
+ beIndex ID = 53
+ beBYIndex ID = 54
+ bemIndex ID = 55
+ bemZMIndex ID = 56
+ bezIndex ID = 57
+ bezTZIndex ID = 58
+ bgIndex ID = 59
+ bgBGIndex ID = 60
+ bhIndex ID = 61
+ bmIndex ID = 62
+ bmMLIndex ID = 63
+ bnIndex ID = 64
+ bnBDIndex ID = 65
+ bnINIndex ID = 66
+ boIndex ID = 67
+ boCNIndex ID = 68
+ boINIndex ID = 69
+ brIndex ID = 70
+ brFRIndex ID = 71
+ brxIndex ID = 72
+ brxINIndex ID = 73
+ bsIndex ID = 74
+ bsCyrlIndex ID = 75
+ bsCyrlBAIndex ID = 76
+ bsLatnIndex ID = 77
+ bsLatnBAIndex ID = 78
+ caIndex ID = 79
+ caADIndex ID = 80
+ caESIndex ID = 81
+ caFRIndex ID = 82
+ caITIndex ID = 83
+ ccpIndex ID = 84
+ ccpBDIndex ID = 85
+ ccpINIndex ID = 86
+ ceIndex ID = 87
+ ceRUIndex ID = 88
+ cggIndex ID = 89
+ cggUGIndex ID = 90
+ chrIndex ID = 91
+ chrUSIndex ID = 92
+ ckbIndex ID = 93
+ ckbIQIndex ID = 94
+ ckbIRIndex ID = 95
+ csIndex ID = 96
+ csCZIndex ID = 97
+ cuIndex ID = 98
+ cuRUIndex ID = 99
+ cyIndex ID = 100
+ cyGBIndex ID = 101
+ daIndex ID = 102
+ daDKIndex ID = 103
+ daGLIndex ID = 104
+ davIndex ID = 105
+ davKEIndex ID = 106
+ deIndex ID = 107
+ deATIndex ID = 108
+ deBEIndex ID = 109
+ deCHIndex ID = 110
+ deDEIndex ID = 111
+ deITIndex ID = 112
+ deLIIndex ID = 113
+ deLUIndex ID = 114
+ djeIndex ID = 115
+ djeNEIndex ID = 116
+ dsbIndex ID = 117
+ dsbDEIndex ID = 118
+ duaIndex ID = 119
+ duaCMIndex ID = 120
+ dvIndex ID = 121
+ dyoIndex ID = 122
+ dyoSNIndex ID = 123
+ dzIndex ID = 124
+ dzBTIndex ID = 125
+ ebuIndex ID = 126
+ ebuKEIndex ID = 127
+ eeIndex ID = 128
+ eeGHIndex ID = 129
+ eeTGIndex ID = 130
+ elIndex ID = 131
+ elCYIndex ID = 132
+ elGRIndex ID = 133
+ enIndex ID = 134
+ en001Index ID = 135
+ en150Index ID = 136
+ enAGIndex ID = 137
+ enAIIndex ID = 138
+ enASIndex ID = 139
+ enATIndex ID = 140
+ enAUIndex ID = 141
+ enBBIndex ID = 142
+ enBEIndex ID = 143
+ enBIIndex ID = 144
+ enBMIndex ID = 145
+ enBSIndex ID = 146
+ enBWIndex ID = 147
+ enBZIndex ID = 148
+ enCAIndex ID = 149
+ enCCIndex ID = 150
+ enCHIndex ID = 151
+ enCKIndex ID = 152
+ enCMIndex ID = 153
+ enCXIndex ID = 154
+ enCYIndex ID = 155
+ enDEIndex ID = 156
+ enDGIndex ID = 157
+ enDKIndex ID = 158
+ enDMIndex ID = 159
+ enERIndex ID = 160
+ enFIIndex ID = 161
+ enFJIndex ID = 162
+ enFKIndex ID = 163
+ enFMIndex ID = 164
+ enGBIndex ID = 165
+ enGDIndex ID = 166
+ enGGIndex ID = 167
+ enGHIndex ID = 168
+ enGIIndex ID = 169
+ enGMIndex ID = 170
+ enGUIndex ID = 171
+ enGYIndex ID = 172
+ enHKIndex ID = 173
+ enIEIndex ID = 174
+ enILIndex ID = 175
+ enIMIndex ID = 176
+ enINIndex ID = 177
+ enIOIndex ID = 178
+ enJEIndex ID = 179
+ enJMIndex ID = 180
+ enKEIndex ID = 181
+ enKIIndex ID = 182
+ enKNIndex ID = 183
+ enKYIndex ID = 184
+ enLCIndex ID = 185
+ enLRIndex ID = 186
+ enLSIndex ID = 187
+ enMGIndex ID = 188
+ enMHIndex ID = 189
+ enMOIndex ID = 190
+ enMPIndex ID = 191
+ enMSIndex ID = 192
+ enMTIndex ID = 193
+ enMUIndex ID = 194
+ enMWIndex ID = 195
+ enMYIndex ID = 196
+ enNAIndex ID = 197
+ enNFIndex ID = 198
+ enNGIndex ID = 199
+ enNLIndex ID = 200
+ enNRIndex ID = 201
+ enNUIndex ID = 202
+ enNZIndex ID = 203
+ enPGIndex ID = 204
+ enPHIndex ID = 205
+ enPKIndex ID = 206
+ enPNIndex ID = 207
+ enPRIndex ID = 208
+ enPWIndex ID = 209
+ enRWIndex ID = 210
+ enSBIndex ID = 211
+ enSCIndex ID = 212
+ enSDIndex ID = 213
+ enSEIndex ID = 214
+ enSGIndex ID = 215
+ enSHIndex ID = 216
+ enSIIndex ID = 217
+ enSLIndex ID = 218
+ enSSIndex ID = 219
+ enSXIndex ID = 220
+ enSZIndex ID = 221
+ enTCIndex ID = 222
+ enTKIndex ID = 223
+ enTOIndex ID = 224
+ enTTIndex ID = 225
+ enTVIndex ID = 226
+ enTZIndex ID = 227
+ enUGIndex ID = 228
+ enUMIndex ID = 229
+ enUSIndex ID = 230
+ enVCIndex ID = 231
+ enVGIndex ID = 232
+ enVIIndex ID = 233
+ enVUIndex ID = 234
+ enWSIndex ID = 235
+ enZAIndex ID = 236
+ enZMIndex ID = 237
+ enZWIndex ID = 238
+ eoIndex ID = 239
+ eo001Index ID = 240
+ esIndex ID = 241
+ es419Index ID = 242
+ esARIndex ID = 243
+ esBOIndex ID = 244
+ esBRIndex ID = 245
+ esBZIndex ID = 246
+ esCLIndex ID = 247
+ esCOIndex ID = 248
+ esCRIndex ID = 249
+ esCUIndex ID = 250
+ esDOIndex ID = 251
+ esEAIndex ID = 252
+ esECIndex ID = 253
+ esESIndex ID = 254
+ esGQIndex ID = 255
+ esGTIndex ID = 256
+ esHNIndex ID = 257
+ esICIndex ID = 258
+ esMXIndex ID = 259
+ esNIIndex ID = 260
+ esPAIndex ID = 261
+ esPEIndex ID = 262
+ esPHIndex ID = 263
+ esPRIndex ID = 264
+ esPYIndex ID = 265
+ esSVIndex ID = 266
+ esUSIndex ID = 267
+ esUYIndex ID = 268
+ esVEIndex ID = 269
+ etIndex ID = 270
+ etEEIndex ID = 271
+ euIndex ID = 272
+ euESIndex ID = 273
+ ewoIndex ID = 274
+ ewoCMIndex ID = 275
+ faIndex ID = 276
+ faAFIndex ID = 277
+ faIRIndex ID = 278
+ ffIndex ID = 279
+ ffCMIndex ID = 280
+ ffGNIndex ID = 281
+ ffMRIndex ID = 282
+ ffSNIndex ID = 283
+ fiIndex ID = 284
+ fiFIIndex ID = 285
+ filIndex ID = 286
+ filPHIndex ID = 287
+ foIndex ID = 288
+ foDKIndex ID = 289
+ foFOIndex ID = 290
+ frIndex ID = 291
+ frBEIndex ID = 292
+ frBFIndex ID = 293
+ frBIIndex ID = 294
+ frBJIndex ID = 295
+ frBLIndex ID = 296
+ frCAIndex ID = 297
+ frCDIndex ID = 298
+ frCFIndex ID = 299
+ frCGIndex ID = 300
+ frCHIndex ID = 301
+ frCIIndex ID = 302
+ frCMIndex ID = 303
+ frDJIndex ID = 304
+ frDZIndex ID = 305
+ frFRIndex ID = 306
+ frGAIndex ID = 307
+ frGFIndex ID = 308
+ frGNIndex ID = 309
+ frGPIndex ID = 310
+ frGQIndex ID = 311
+ frHTIndex ID = 312
+ frKMIndex ID = 313
+ frLUIndex ID = 314
+ frMAIndex ID = 315
+ frMCIndex ID = 316
+ frMFIndex ID = 317
+ frMGIndex ID = 318
+ frMLIndex ID = 319
+ frMQIndex ID = 320
+ frMRIndex ID = 321
+ frMUIndex ID = 322
+ frNCIndex ID = 323
+ frNEIndex ID = 324
+ frPFIndex ID = 325
+ frPMIndex ID = 326
+ frREIndex ID = 327
+ frRWIndex ID = 328
+ frSCIndex ID = 329
+ frSNIndex ID = 330
+ frSYIndex ID = 331
+ frTDIndex ID = 332
+ frTGIndex ID = 333
+ frTNIndex ID = 334
+ frVUIndex ID = 335
+ frWFIndex ID = 336
+ frYTIndex ID = 337
+ furIndex ID = 338
+ furITIndex ID = 339
+ fyIndex ID = 340
+ fyNLIndex ID = 341
+ gaIndex ID = 342
+ gaIEIndex ID = 343
+ gdIndex ID = 344
+ gdGBIndex ID = 345
+ glIndex ID = 346
+ glESIndex ID = 347
+ gswIndex ID = 348
+ gswCHIndex ID = 349
+ gswFRIndex ID = 350
+ gswLIIndex ID = 351
+ guIndex ID = 352
+ guINIndex ID = 353
+ guwIndex ID = 354
+ guzIndex ID = 355
+ guzKEIndex ID = 356
+ gvIndex ID = 357
+ gvIMIndex ID = 358
+ haIndex ID = 359
+ haGHIndex ID = 360
+ haNEIndex ID = 361
+ haNGIndex ID = 362
+ hawIndex ID = 363
+ hawUSIndex ID = 364
+ heIndex ID = 365
+ heILIndex ID = 366
+ hiIndex ID = 367
+ hiINIndex ID = 368
+ hrIndex ID = 369
+ hrBAIndex ID = 370
+ hrHRIndex ID = 371
+ hsbIndex ID = 372
+ hsbDEIndex ID = 373
+ huIndex ID = 374
+ huHUIndex ID = 375
+ hyIndex ID = 376
+ hyAMIndex ID = 377
+ idIndex ID = 378
+ idIDIndex ID = 379
+ igIndex ID = 380
+ igNGIndex ID = 381
+ iiIndex ID = 382
+ iiCNIndex ID = 383
+ inIndex ID = 384
+ ioIndex ID = 385
+ isIndex ID = 386
+ isISIndex ID = 387
+ itIndex ID = 388
+ itCHIndex ID = 389
+ itITIndex ID = 390
+ itSMIndex ID = 391
+ itVAIndex ID = 392
+ iuIndex ID = 393
+ iwIndex ID = 394
+ jaIndex ID = 395
+ jaJPIndex ID = 396
+ jboIndex ID = 397
+ jgoIndex ID = 398
+ jgoCMIndex ID = 399
+ jiIndex ID = 400
+ jmcIndex ID = 401
+ jmcTZIndex ID = 402
+ jvIndex ID = 403
+ jwIndex ID = 404
+ kaIndex ID = 405
+ kaGEIndex ID = 406
+ kabIndex ID = 407
+ kabDZIndex ID = 408
+ kajIndex ID = 409
+ kamIndex ID = 410
+ kamKEIndex ID = 411
+ kcgIndex ID = 412
+ kdeIndex ID = 413
+ kdeTZIndex ID = 414
+ keaIndex ID = 415
+ keaCVIndex ID = 416
+ khqIndex ID = 417
+ khqMLIndex ID = 418
+ kiIndex ID = 419
+ kiKEIndex ID = 420
+ kkIndex ID = 421
+ kkKZIndex ID = 422
+ kkjIndex ID = 423
+ kkjCMIndex ID = 424
+ klIndex ID = 425
+ klGLIndex ID = 426
+ klnIndex ID = 427
+ klnKEIndex ID = 428
+ kmIndex ID = 429
+ kmKHIndex ID = 430
+ knIndex ID = 431
+ knINIndex ID = 432
+ koIndex ID = 433
+ koKPIndex ID = 434
+ koKRIndex ID = 435
+ kokIndex ID = 436
+ kokINIndex ID = 437
+ ksIndex ID = 438
+ ksINIndex ID = 439
+ ksbIndex ID = 440
+ ksbTZIndex ID = 441
+ ksfIndex ID = 442
+ ksfCMIndex ID = 443
+ kshIndex ID = 444
+ kshDEIndex ID = 445
+ kuIndex ID = 446
+ kwIndex ID = 447
+ kwGBIndex ID = 448
+ kyIndex ID = 449
+ kyKGIndex ID = 450
+ lagIndex ID = 451
+ lagTZIndex ID = 452
+ lbIndex ID = 453
+ lbLUIndex ID = 454
+ lgIndex ID = 455
+ lgUGIndex ID = 456
+ lktIndex ID = 457
+ lktUSIndex ID = 458
+ lnIndex ID = 459
+ lnAOIndex ID = 460
+ lnCDIndex ID = 461
+ lnCFIndex ID = 462
+ lnCGIndex ID = 463
+ loIndex ID = 464
+ loLAIndex ID = 465
+ lrcIndex ID = 466
+ lrcIQIndex ID = 467
+ lrcIRIndex ID = 468
+ ltIndex ID = 469
+ ltLTIndex ID = 470
+ luIndex ID = 471
+ luCDIndex ID = 472
+ luoIndex ID = 473
+ luoKEIndex ID = 474
+ luyIndex ID = 475
+ luyKEIndex ID = 476
+ lvIndex ID = 477
+ lvLVIndex ID = 478
+ masIndex ID = 479
+ masKEIndex ID = 480
+ masTZIndex ID = 481
+ merIndex ID = 482
+ merKEIndex ID = 483
+ mfeIndex ID = 484
+ mfeMUIndex ID = 485
+ mgIndex ID = 486
+ mgMGIndex ID = 487
+ mghIndex ID = 488
+ mghMZIndex ID = 489
+ mgoIndex ID = 490
+ mgoCMIndex ID = 491
+ mkIndex ID = 492
+ mkMKIndex ID = 493
+ mlIndex ID = 494
+ mlINIndex ID = 495
+ mnIndex ID = 496
+ mnMNIndex ID = 497
+ moIndex ID = 498
+ mrIndex ID = 499
+ mrINIndex ID = 500
+ msIndex ID = 501
+ msBNIndex ID = 502
+ msMYIndex ID = 503
+ msSGIndex ID = 504
+ mtIndex ID = 505
+ mtMTIndex ID = 506
+ muaIndex ID = 507
+ muaCMIndex ID = 508
+ myIndex ID = 509
+ myMMIndex ID = 510
+ mznIndex ID = 511
+ mznIRIndex ID = 512
+ nahIndex ID = 513
+ naqIndex ID = 514
+ naqNAIndex ID = 515
+ nbIndex ID = 516
+ nbNOIndex ID = 517
+ nbSJIndex ID = 518
+ ndIndex ID = 519
+ ndZWIndex ID = 520
+ ndsIndex ID = 521
+ ndsDEIndex ID = 522
+ ndsNLIndex ID = 523
+ neIndex ID = 524
+ neINIndex ID = 525
+ neNPIndex ID = 526
+ nlIndex ID = 527
+ nlAWIndex ID = 528
+ nlBEIndex ID = 529
+ nlBQIndex ID = 530
+ nlCWIndex ID = 531
+ nlNLIndex ID = 532
+ nlSRIndex ID = 533
+ nlSXIndex ID = 534
+ nmgIndex ID = 535
+ nmgCMIndex ID = 536
+ nnIndex ID = 537
+ nnNOIndex ID = 538
+ nnhIndex ID = 539
+ nnhCMIndex ID = 540
+ noIndex ID = 541
+ nqoIndex ID = 542
+ nrIndex ID = 543
+ nsoIndex ID = 544
+ nusIndex ID = 545
+ nusSSIndex ID = 546
+ nyIndex ID = 547
+ nynIndex ID = 548
+ nynUGIndex ID = 549
+ omIndex ID = 550
+ omETIndex ID = 551
+ omKEIndex ID = 552
+ orIndex ID = 553
+ orINIndex ID = 554
+ osIndex ID = 555
+ osGEIndex ID = 556
+ osRUIndex ID = 557
+ paIndex ID = 558
+ paArabIndex ID = 559
+ paArabPKIndex ID = 560
+ paGuruIndex ID = 561
+ paGuruINIndex ID = 562
+ papIndex ID = 563
+ plIndex ID = 564
+ plPLIndex ID = 565
+ prgIndex ID = 566
+ prg001Index ID = 567
+ psIndex ID = 568
+ psAFIndex ID = 569
+ ptIndex ID = 570
+ ptAOIndex ID = 571
+ ptBRIndex ID = 572
+ ptCHIndex ID = 573
+ ptCVIndex ID = 574
+ ptGQIndex ID = 575
+ ptGWIndex ID = 576
+ ptLUIndex ID = 577
+ ptMOIndex ID = 578
+ ptMZIndex ID = 579
+ ptPTIndex ID = 580
+ ptSTIndex ID = 581
+ ptTLIndex ID = 582
+ quIndex ID = 583
+ quBOIndex ID = 584
+ quECIndex ID = 585
+ quPEIndex ID = 586
+ rmIndex ID = 587
+ rmCHIndex ID = 588
+ rnIndex ID = 589
+ rnBIIndex ID = 590
+ roIndex ID = 591
+ roMDIndex ID = 592
+ roROIndex ID = 593
+ rofIndex ID = 594
+ rofTZIndex ID = 595
+ ruIndex ID = 596
+ ruBYIndex ID = 597
+ ruKGIndex ID = 598
+ ruKZIndex ID = 599
+ ruMDIndex ID = 600
+ ruRUIndex ID = 601
+ ruUAIndex ID = 602
+ rwIndex ID = 603
+ rwRWIndex ID = 604
+ rwkIndex ID = 605
+ rwkTZIndex ID = 606
+ sahIndex ID = 607
+ sahRUIndex ID = 608
+ saqIndex ID = 609
+ saqKEIndex ID = 610
+ sbpIndex ID = 611
+ sbpTZIndex ID = 612
+ sdIndex ID = 613
+ sdPKIndex ID = 614
+ sdhIndex ID = 615
+ seIndex ID = 616
+ seFIIndex ID = 617
+ seNOIndex ID = 618
+ seSEIndex ID = 619
+ sehIndex ID = 620
+ sehMZIndex ID = 621
+ sesIndex ID = 622
+ sesMLIndex ID = 623
+ sgIndex ID = 624
+ sgCFIndex ID = 625
+ shIndex ID = 626
+ shiIndex ID = 627
+ shiLatnIndex ID = 628
+ shiLatnMAIndex ID = 629
+ shiTfngIndex ID = 630
+ shiTfngMAIndex ID = 631
+ siIndex ID = 632
+ siLKIndex ID = 633
+ skIndex ID = 634
+ skSKIndex ID = 635
+ slIndex ID = 636
+ slSIIndex ID = 637
+ smaIndex ID = 638
+ smiIndex ID = 639
+ smjIndex ID = 640
+ smnIndex ID = 641
+ smnFIIndex ID = 642
+ smsIndex ID = 643
+ snIndex ID = 644
+ snZWIndex ID = 645
+ soIndex ID = 646
+ soDJIndex ID = 647
+ soETIndex ID = 648
+ soKEIndex ID = 649
+ soSOIndex ID = 650
+ sqIndex ID = 651
+ sqALIndex ID = 652
+ sqMKIndex ID = 653
+ sqXKIndex ID = 654
+ srIndex ID = 655
+ srCyrlIndex ID = 656
+ srCyrlBAIndex ID = 657
+ srCyrlMEIndex ID = 658
+ srCyrlRSIndex ID = 659
+ srCyrlXKIndex ID = 660
+ srLatnIndex ID = 661
+ srLatnBAIndex ID = 662
+ srLatnMEIndex ID = 663
+ srLatnRSIndex ID = 664
+ srLatnXKIndex ID = 665
+ ssIndex ID = 666
+ ssyIndex ID = 667
+ stIndex ID = 668
+ svIndex ID = 669
+ svAXIndex ID = 670
+ svFIIndex ID = 671
+ svSEIndex ID = 672
+ swIndex ID = 673
+ swCDIndex ID = 674
+ swKEIndex ID = 675
+ swTZIndex ID = 676
+ swUGIndex ID = 677
+ syrIndex ID = 678
+ taIndex ID = 679
+ taINIndex ID = 680
+ taLKIndex ID = 681
+ taMYIndex ID = 682
+ taSGIndex ID = 683
+ teIndex ID = 684
+ teINIndex ID = 685
+ teoIndex ID = 686
+ teoKEIndex ID = 687
+ teoUGIndex ID = 688
+ tgIndex ID = 689
+ tgTJIndex ID = 690
+ thIndex ID = 691
+ thTHIndex ID = 692
+ tiIndex ID = 693
+ tiERIndex ID = 694
+ tiETIndex ID = 695
+ tigIndex ID = 696
+ tkIndex ID = 697
+ tkTMIndex ID = 698
+ tlIndex ID = 699
+ tnIndex ID = 700
+ toIndex ID = 701
+ toTOIndex ID = 702
+ trIndex ID = 703
+ trCYIndex ID = 704
+ trTRIndex ID = 705
+ tsIndex ID = 706
+ ttIndex ID = 707
+ ttRUIndex ID = 708
+ twqIndex ID = 709
+ twqNEIndex ID = 710
+ tzmIndex ID = 711
+ tzmMAIndex ID = 712
+ ugIndex ID = 713
+ ugCNIndex ID = 714
+ ukIndex ID = 715
+ ukUAIndex ID = 716
+ urIndex ID = 717
+ urINIndex ID = 718
+ urPKIndex ID = 719
+ uzIndex ID = 720
+ uzArabIndex ID = 721
+ uzArabAFIndex ID = 722
+ uzCyrlIndex ID = 723
+ uzCyrlUZIndex ID = 724
+ uzLatnIndex ID = 725
+ uzLatnUZIndex ID = 726
+ vaiIndex ID = 727
+ vaiLatnIndex ID = 728
+ vaiLatnLRIndex ID = 729
+ vaiVaiiIndex ID = 730
+ vaiVaiiLRIndex ID = 731
+ veIndex ID = 732
+ viIndex ID = 733
+ viVNIndex ID = 734
+ voIndex ID = 735
+ vo001Index ID = 736
+ vunIndex ID = 737
+ vunTZIndex ID = 738
+ waIndex ID = 739
+ waeIndex ID = 740
+ waeCHIndex ID = 741
+ woIndex ID = 742
+ woSNIndex ID = 743
+ xhIndex ID = 744
+ xogIndex ID = 745
+ xogUGIndex ID = 746
+ yavIndex ID = 747
+ yavCMIndex ID = 748
+ yiIndex ID = 749
+ yi001Index ID = 750
+ yoIndex ID = 751
+ yoBJIndex ID = 752
+ yoNGIndex ID = 753
+ yueIndex ID = 754
+ yueHansIndex ID = 755
+ yueHansCNIndex ID = 756
+ yueHantIndex ID = 757
+ yueHantHKIndex ID = 758
+ zghIndex ID = 759
+ zghMAIndex ID = 760
+ zhIndex ID = 761
+ zhHansIndex ID = 762
+ zhHansCNIndex ID = 763
+ zhHansHKIndex ID = 764
+ zhHansMOIndex ID = 765
+ zhHansSGIndex ID = 766
+ zhHantIndex ID = 767
+ zhHantHKIndex ID = 768
+ zhHantMOIndex ID = 769
+ zhHantTWIndex ID = 770
+ zuIndex ID = 771
+ zuZAIndex ID = 772
+ caESvalenciaIndex ID = 773
+ enUSuvaposixIndex ID = 774
+)
+
+var coreTags = []language.CompactCoreInfo{ // 773 elements
+ // Entry 0 - 1F
+ 0x00000000, 0x01600000, 0x016000d2, 0x01600161,
+ 0x01c00000, 0x01c00052, 0x02100000, 0x02100080,
+ 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001,
+ 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067,
+ 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097,
+ 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac,
+ 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9,
+ 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108,
+ // Entry 20 - 3F
+ 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c,
+ 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000,
+ 0x04300000, 0x04300099, 0x04400000, 0x0440012f,
+ 0x04800000, 0x0480006e, 0x05800000, 0x0581f000,
+ 0x0581f032, 0x05857000, 0x05857032, 0x05e00000,
+ 0x05e00052, 0x07100000, 0x07100047, 0x07500000,
+ 0x07500162, 0x07900000, 0x0790012f, 0x07e00000,
+ 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3,
+ // Entry 40 - 5F
+ 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000,
+ 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078,
+ 0x0b500000, 0x0b500099, 0x0b700000, 0x0b71f000,
+ 0x0b71f033, 0x0b757000, 0x0b757033, 0x0d700000,
+ 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e,
+ 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000,
+ 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000,
+ 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c,
+ // Entry 60 - 7F
+ 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106,
+ 0x10000000, 0x1000007b, 0x10100000, 0x10100063,
+ 0x10100082, 0x10800000, 0x108000a4, 0x10d00000,
+ 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060,
+ 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000,
+ 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000,
+ 0x12400052, 0x12800000, 0x12b00000, 0x12b00114,
+ 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4,
+ // Entry 80 - 9F
+ 0x13000000, 0x13000080, 0x13000122, 0x13600000,
+ 0x1360005d, 0x13600087, 0x13900000, 0x13900001,
+ 0x1390001a, 0x13900025, 0x13900026, 0x1390002d,
+ 0x1390002e, 0x1390002f, 0x13900034, 0x13900036,
+ 0x1390003a, 0x1390003d, 0x13900042, 0x13900046,
+ 0x13900048, 0x13900049, 0x1390004a, 0x1390004e,
+ 0x13900050, 0x13900052, 0x1390005c, 0x1390005d,
+ 0x13900060, 0x13900061, 0x13900063, 0x13900064,
+ // Entry A0 - BF
+ 0x1390006d, 0x13900072, 0x13900073, 0x13900074,
+ 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f,
+ 0x13900080, 0x13900081, 0x13900083, 0x1390008a,
+ 0x1390008c, 0x1390008d, 0x13900096, 0x13900097,
+ 0x13900098, 0x13900099, 0x1390009a, 0x1390009f,
+ 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9,
+ 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5,
+ 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7,
+ // Entry C0 - DF
+ 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce,
+ 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6,
+ 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0,
+ 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb,
+ 0x139000ec, 0x139000f0, 0x13900107, 0x13900109,
+ 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d,
+ 0x1390010e, 0x1390010f, 0x13900112, 0x13900117,
+ 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125,
+ // Entry E0 - FF
+ 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f,
+ 0x13900131, 0x13900133, 0x13900135, 0x13900139,
+ 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142,
+ 0x13900161, 0x13900162, 0x13900164, 0x13c00000,
+ 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c,
+ 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051,
+ 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065,
+ 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086,
+ // Entry 100 - 11F
+ 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf,
+ 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7,
+ 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135,
+ 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a,
+ 0x14500000, 0x1450006e, 0x14600000, 0x14600052,
+ 0x14800000, 0x14800024, 0x1480009c, 0x14e00000,
+ 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114,
+ 0x15100000, 0x15100072, 0x15300000, 0x153000e7,
+ // Entry 120 - 13F
+ 0x15800000, 0x15800063, 0x15800076, 0x15e00000,
+ 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b,
+ 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c,
+ 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052,
+ 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a,
+ 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086,
+ 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba,
+ 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3,
+ // Entry 140 - 15F
+ 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3,
+ 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102,
+ 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c,
+ 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f,
+ 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e,
+ 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096,
+ 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e,
+ 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2,
+ // Entry 160 - 17F
+ 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000,
+ 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000,
+ 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000,
+ 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000,
+ 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090,
+ 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092,
+ 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095,
+ 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053,
+ // Entry 180 - 19F
+ 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d,
+ 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113,
+ 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000,
+ 0x200000a2, 0x20300000, 0x20700000, 0x20700052,
+ 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000,
+ 0x20f00000, 0x21000000, 0x2100007d, 0x21200000,
+ 0x21200067, 0x21600000, 0x21700000, 0x217000a4,
+ 0x21f00000, 0x22300000, 0x2230012f, 0x22700000,
+ // Entry 1A0 - 1BF
+ 0x2270005a, 0x23400000, 0x234000c3, 0x23900000,
+ 0x239000a4, 0x24200000, 0x242000ae, 0x24400000,
+ 0x24400052, 0x24500000, 0x24500082, 0x24600000,
+ 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000,
+ 0x25100099, 0x25400000, 0x254000aa, 0x254000ab,
+ 0x25600000, 0x25600099, 0x26a00000, 0x26a00099,
+ 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052,
+ 0x26e00000, 0x26e00060, 0x27400000, 0x28100000,
+ // Entry 1C0 - 1DF
+ 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000,
+ 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000,
+ 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000,
+ 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d,
+ 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b,
+ 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000,
+ 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000,
+ 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000,
+ // Entry 1E0 - 1FF
+ 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4,
+ 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf,
+ 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052,
+ 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099,
+ 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000,
+ 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0,
+ 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000,
+ 0x32500052, 0x33100000, 0x331000c4, 0x33a00000,
+ // Entry 200 - 21F
+ 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2,
+ 0x34700000, 0x347000da, 0x34700110, 0x34e00000,
+ 0x34e00164, 0x35000000, 0x35000060, 0x350000d9,
+ 0x35100000, 0x35100099, 0x351000db, 0x36700000,
+ 0x36700030, 0x36700036, 0x36700040, 0x3670005b,
+ 0x367000d9, 0x36700116, 0x3670011b, 0x36800000,
+ 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000,
+ 0x36c00052, 0x36f00000, 0x37500000, 0x37600000,
+ // Entry 220 - 23F
+ 0x37a00000, 0x38000000, 0x38000117, 0x38700000,
+ 0x38900000, 0x38900131, 0x39000000, 0x3900006f,
+ 0x390000a4, 0x39500000, 0x39500099, 0x39800000,
+ 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000,
+ 0x39d050e8, 0x39d33000, 0x39d33099, 0x3a100000,
+ 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001,
+ 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a,
+ 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086,
+ // Entry 240 - 25F
+ 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1,
+ 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000,
+ 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000,
+ 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000,
+ 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f,
+ 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae,
+ 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000,
+ 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000,
+ // Entry 260 - 27F
+ 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000,
+ 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000,
+ 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c,
+ 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3,
+ 0x40200000, 0x4020004c, 0x40700000, 0x40800000,
+ 0x40857000, 0x408570ba, 0x408dc000, 0x408dc0ba,
+ 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111,
+ 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000,
+ // Entry 280 - 29F
+ 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000,
+ 0x42300000, 0x42300164, 0x42900000, 0x42900062,
+ 0x4290006f, 0x429000a4, 0x42900115, 0x43100000,
+ 0x43100027, 0x431000c2, 0x4310014d, 0x43200000,
+ 0x4321f000, 0x4321f033, 0x4321f0bd, 0x4321f105,
+ 0x4321f14d, 0x43257000, 0x43257033, 0x432570bd,
+ 0x43257105, 0x4325714d, 0x43700000, 0x43a00000,
+ 0x43b00000, 0x44400000, 0x44400031, 0x44400072,
+ // Entry 2A0 - 2BF
+ 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4,
+ 0x4450012f, 0x44500131, 0x44e00000, 0x45000000,
+ 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d,
+ 0x46100000, 0x46100099, 0x46400000, 0x464000a4,
+ 0x46400131, 0x46700000, 0x46700124, 0x46b00000,
+ 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f,
+ 0x47100000, 0x47600000, 0x47600127, 0x47a00000,
+ 0x48000000, 0x48200000, 0x48200129, 0x48a00000,
+ // Entry 2C0 - 2DF
+ 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000,
+ 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000,
+ 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000,
+ 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8,
+ 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc1f000,
+ 0x4bc1f137, 0x4bc57000, 0x4bc57137, 0x4be00000,
+ 0x4be57000, 0x4be570b4, 0x4bee3000, 0x4bee30b4,
+ 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000,
+ // Entry 2E0 - 2FF
+ 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000,
+ 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114,
+ 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000,
+ 0x50900052, 0x51200000, 0x51200001, 0x51800000,
+ 0x5180003b, 0x518000d6, 0x51f00000, 0x51f38000,
+ 0x51f38053, 0x51f39000, 0x51f3908d, 0x52800000,
+ 0x528000ba, 0x52900000, 0x52938000, 0x52938053,
+ 0x5293808d, 0x529380c6, 0x5293810d, 0x52939000,
+ // Entry 300 - 31F
+ 0x5293908d, 0x529390c6, 0x5293912e, 0x52f00000,
+ 0x52f00161,
+} // Size: 3116 bytes
+
+const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix"
+
+// Total table size 3147 bytes (3KiB); checksum: F4E57D15
diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go
new file mode 100644
index 00000000..ca135d29
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compact/tags.go
@@ -0,0 +1,91 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package compact
+
+var (
+ und = Tag{}
+
+ Und Tag = Tag{}
+
+ Afrikaans Tag = Tag{language: afIndex, locale: afIndex}
+ Amharic Tag = Tag{language: amIndex, locale: amIndex}
+ Arabic Tag = Tag{language: arIndex, locale: arIndex}
+ ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index}
+ Azerbaijani Tag = Tag{language: azIndex, locale: azIndex}
+ Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex}
+ Bengali Tag = Tag{language: bnIndex, locale: bnIndex}
+ Catalan Tag = Tag{language: caIndex, locale: caIndex}
+ Czech Tag = Tag{language: csIndex, locale: csIndex}
+ Danish Tag = Tag{language: daIndex, locale: daIndex}
+ German Tag = Tag{language: deIndex, locale: deIndex}
+ Greek Tag = Tag{language: elIndex, locale: elIndex}
+ English Tag = Tag{language: enIndex, locale: enIndex}
+ AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex}
+ BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex}
+ Spanish Tag = Tag{language: esIndex, locale: esIndex}
+ EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex}
+ LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index}
+ Estonian Tag = Tag{language: etIndex, locale: etIndex}
+ Persian Tag = Tag{language: faIndex, locale: faIndex}
+ Finnish Tag = Tag{language: fiIndex, locale: fiIndex}
+ Filipino Tag = Tag{language: filIndex, locale: filIndex}
+ French Tag = Tag{language: frIndex, locale: frIndex}
+ CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex}
+ Gujarati Tag = Tag{language: guIndex, locale: guIndex}
+ Hebrew Tag = Tag{language: heIndex, locale: heIndex}
+ Hindi Tag = Tag{language: hiIndex, locale: hiIndex}
+ Croatian Tag = Tag{language: hrIndex, locale: hrIndex}
+ Hungarian Tag = Tag{language: huIndex, locale: huIndex}
+ Armenian Tag = Tag{language: hyIndex, locale: hyIndex}
+ Indonesian Tag = Tag{language: idIndex, locale: idIndex}
+ Icelandic Tag = Tag{language: isIndex, locale: isIndex}
+ Italian Tag = Tag{language: itIndex, locale: itIndex}
+ Japanese Tag = Tag{language: jaIndex, locale: jaIndex}
+ Georgian Tag = Tag{language: kaIndex, locale: kaIndex}
+ Kazakh Tag = Tag{language: kkIndex, locale: kkIndex}
+ Khmer Tag = Tag{language: kmIndex, locale: kmIndex}
+ Kannada Tag = Tag{language: knIndex, locale: knIndex}
+ Korean Tag = Tag{language: koIndex, locale: koIndex}
+ Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex}
+ Lao Tag = Tag{language: loIndex, locale: loIndex}
+ Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex}
+ Latvian Tag = Tag{language: lvIndex, locale: lvIndex}
+ Macedonian Tag = Tag{language: mkIndex, locale: mkIndex}
+ Malayalam Tag = Tag{language: mlIndex, locale: mlIndex}
+ Mongolian Tag = Tag{language: mnIndex, locale: mnIndex}
+ Marathi Tag = Tag{language: mrIndex, locale: mrIndex}
+ Malay Tag = Tag{language: msIndex, locale: msIndex}
+ Burmese Tag = Tag{language: myIndex, locale: myIndex}
+ Nepali Tag = Tag{language: neIndex, locale: neIndex}
+ Dutch Tag = Tag{language: nlIndex, locale: nlIndex}
+ Norwegian Tag = Tag{language: noIndex, locale: noIndex}
+ Punjabi Tag = Tag{language: paIndex, locale: paIndex}
+ Polish Tag = Tag{language: plIndex, locale: plIndex}
+ Portuguese Tag = Tag{language: ptIndex, locale: ptIndex}
+ BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex}
+ EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex}
+ Romanian Tag = Tag{language: roIndex, locale: roIndex}
+ Russian Tag = Tag{language: ruIndex, locale: ruIndex}
+ Sinhala Tag = Tag{language: siIndex, locale: siIndex}
+ Slovak Tag = Tag{language: skIndex, locale: skIndex}
+ Slovenian Tag = Tag{language: slIndex, locale: slIndex}
+ Albanian Tag = Tag{language: sqIndex, locale: sqIndex}
+ Serbian Tag = Tag{language: srIndex, locale: srIndex}
+ SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex}
+ Swedish Tag = Tag{language: svIndex, locale: svIndex}
+ Swahili Tag = Tag{language: swIndex, locale: swIndex}
+ Tamil Tag = Tag{language: taIndex, locale: taIndex}
+ Telugu Tag = Tag{language: teIndex, locale: teIndex}
+ Thai Tag = Tag{language: thIndex, locale: thIndex}
+ Turkish Tag = Tag{language: trIndex, locale: trIndex}
+ Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex}
+ Urdu Tag = Tag{language: urIndex, locale: urIndex}
+ Uzbek Tag = Tag{language: uzIndex, locale: uzIndex}
+ Vietnamese Tag = Tag{language: viIndex, locale: viIndex}
+ Chinese Tag = Tag{language: zhIndex, locale: zhIndex}
+ SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex}
+ TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex}
+ Zulu Tag = Tag{language: zuIndex, locale: zuIndex}
+)
diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go
new file mode 100644
index 00000000..4ae78e0f
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/compose.go
@@ -0,0 +1,167 @@
+// Copyright 2018 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "sort"
+ "strings"
+)
+
+// A Builder allows constructing a Tag from individual components.
+// Its main user is Compose in the top-level language package.
+type Builder struct {
+ Tag Tag
+
+ private string // the x extension
+ variants []string
+ extensions []string
+}
+
+// Make returns a new Tag from the current settings.
+func (b *Builder) Make() Tag {
+ t := b.Tag
+
+ if len(b.extensions) > 0 || len(b.variants) > 0 {
+ sort.Sort(sortVariants(b.variants))
+ sort.Strings(b.extensions)
+
+ if b.private != "" {
+ b.extensions = append(b.extensions, b.private)
+ }
+ n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...)
+ buf := make([]byte, n)
+ p := t.genCoreBytes(buf)
+ t.pVariant = byte(p)
+ p += appendTokens(buf[p:], b.variants...)
+ t.pExt = uint16(p)
+ p += appendTokens(buf[p:], b.extensions...)
+ t.str = string(buf[:p])
+ // We may not always need to remake the string, but when or when not
+ // to do so is rather tricky.
+ scan := makeScanner(buf[:p])
+ t, _ = parse(&scan, "")
+ return t
+
+ } else if b.private != "" {
+ t.str = b.private
+ t.RemakeString()
+ }
+ return t
+}
+
+// SetTag copies all the settings from a given Tag. Any previously set values
+// are discarded.
+func (b *Builder) SetTag(t Tag) {
+ b.Tag.LangID = t.LangID
+ b.Tag.RegionID = t.RegionID
+ b.Tag.ScriptID = t.ScriptID
+ // TODO: optimize
+ b.variants = b.variants[:0]
+ if variants := t.Variants(); variants != "" {
+ for _, vr := range strings.Split(variants[1:], "-") {
+ b.variants = append(b.variants, vr)
+ }
+ }
+ b.extensions, b.private = b.extensions[:0], ""
+ for _, e := range t.Extensions() {
+ b.AddExt(e)
+ }
+}
+
+// AddExt adds extension e to the tag. e must be a valid extension as returned
+// by Tag.Extension. If the extension already exists, it will be discarded,
+// except for a -u extension, where non-existing key-type pairs will added.
+func (b *Builder) AddExt(e string) {
+ if e[0] == 'x' {
+ if b.private == "" {
+ b.private = e
+ }
+ return
+ }
+ for i, s := range b.extensions {
+ if s[0] == e[0] {
+ if e[0] == 'u' {
+ b.extensions[i] += e[1:]
+ }
+ return
+ }
+ }
+ b.extensions = append(b.extensions, e)
+}
+
+// SetExt sets the extension e to the tag. e must be a valid extension as
+// returned by Tag.Extension. If the extension already exists, it will be
+// overwritten, except for a -u extension, where the individual key-type pairs
+// will be set.
+func (b *Builder) SetExt(e string) {
+ if e[0] == 'x' {
+ b.private = e
+ return
+ }
+ for i, s := range b.extensions {
+ if s[0] == e[0] {
+ if e[0] == 'u' {
+ b.extensions[i] = e + s[1:]
+ } else {
+ b.extensions[i] = e
+ }
+ return
+ }
+ }
+ b.extensions = append(b.extensions, e)
+}
+
+// AddVariant adds any number of variants.
+func (b *Builder) AddVariant(v ...string) {
+ for _, v := range v {
+ if v != "" {
+ b.variants = append(b.variants, v)
+ }
+ }
+}
+
+// ClearVariants removes any variants previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearVariants() {
+ b.variants = b.variants[:0]
+}
+
+// ClearExtensions removes any extensions previously added, including those
+// copied from a Tag in SetTag.
+func (b *Builder) ClearExtensions() {
+ b.private = ""
+ b.extensions = b.extensions[:0]
+}
+
+func tokenLen(token ...string) (n int) {
+ for _, t := range token {
+ n += len(t) + 1
+ }
+ return
+}
+
+func appendTokens(b []byte, token ...string) int {
+ p := 0
+ for _, t := range token {
+ b[p] = '-'
+ copy(b[p+1:], t)
+ p += 1 + len(t)
+ }
+ return p
+}
+
+type sortVariants []string
+
+func (s sortVariants) Len() int {
+ return len(s)
+}
+
+func (s sortVariants) Swap(i, j int) {
+ s[j], s[i] = s[i], s[j]
+}
+
+func (s sortVariants) Less(i, j int) bool {
+ return variantIndex[s[i]] < variantIndex[s[j]]
+}
diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go
new file mode 100644
index 00000000..9b20b88f
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/coverage.go
@@ -0,0 +1,28 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// BaseLanguages returns the list of all supported base languages. It generates
+// the list by traversing the internal structures.
+func BaseLanguages() []Language {
+ base := make([]Language, 0, NumLanguages)
+ for i := 0; i < langNoIndexOffset; i++ {
+ // We included "und" already for the value 0.
+ if i != nonCanonicalUnd {
+ base = append(base, Language(i))
+ }
+ }
+ i := langNoIndexOffset
+ for _, v := range langNoIndex {
+ for k := 0; k < 8; k++ {
+ if v&1 == 1 {
+ base = append(base, Language(i))
+ }
+ v >>= 1
+ i++
+ }
+ }
+ return base
+}
diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go
new file mode 100644
index 00000000..1e74d1af
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/language.go
@@ -0,0 +1,596 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go gen_common.go -output tables.go
+
+package language // import "golang.org/x/text/internal/language"
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+ "errors"
+ "fmt"
+ "strings"
+)
+
+const (
+ // maxCoreSize is the maximum size of a BCP 47 tag without variants and
+ // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
+ maxCoreSize = 12
+
+ // max99thPercentileSize is a somewhat arbitrary buffer size that presumably
+ // is large enough to hold at least 99% of the BCP 47 tags.
+ max99thPercentileSize = 32
+
+ // maxSimpleUExtensionSize is the maximum size of a -u extension with one
+ // key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
+ maxSimpleUExtensionSize = 14
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed. The zero value of Tag is Und.
+type Tag struct {
+ // TODO: the following fields have the form TagTypeID. This name is chosen
+ // to allow refactoring the public package without conflicting with its
+ // Base, Script, and Region methods. Once the transition is fully completed
+ // the ID can be stripped from the name.
+
+ LangID Language
+ RegionID Region
+ // TODO: we will soon run out of positions for ScriptID. Idea: instead of
+ // storing lang, region, and ScriptID codes, store only the compact index and
+ // have a lookup table from this code to its expansion. This greatly speeds
+ // up table lookup, speed up common variant cases.
+ // This will also immediately free up 3 extra bytes. Also, the pVariant
+ // field can now be moved to the lookup table, as the compact index uniquely
+ // determines the offset of a possible variant.
+ ScriptID Script
+ pVariant byte // offset in str, includes preceding '-'
+ pExt uint16 // offset of first extension, includes preceding '-'
+
+ // str is the string representation of the Tag. It will only be used if the
+ // tag has variants or extensions.
+ str string
+}
+
+// Make is a convenience wrapper for Parse that omits the error.
+// In case of an error, a sensible default is returned.
+func Make(s string) Tag {
+ t, _ := Parse(s)
+ return t
+}
+
+// Raw returns the raw base language, script and region, without making an
+// attempt to infer their values.
+// TODO: consider removing
+func (t Tag) Raw() (b Language, s Script, r Region) {
+ return t.LangID, t.ScriptID, t.RegionID
+}
+
+// equalTags compares language, script and region subtags only.
+func (t Tag) equalTags(a Tag) bool {
+ return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+ if int(t.pVariant) < len(t.str) {
+ return false
+ }
+ return t.equalTags(Und)
+}
+
+// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use
+// tag.
+func (t Tag) IsPrivateUse() bool {
+ return t.str != "" && t.pVariant == 0
+}
+
+// RemakeString is used to update t.str in case lang, script or region changed.
+// It is assumed that pExt and pVariant still point to the start of the
+// respective parts.
+func (t *Tag) RemakeString() {
+ if t.str == "" {
+ return
+ }
+ extra := t.str[t.pVariant:]
+ if t.pVariant > 0 {
+ extra = extra[1:]
+ }
+ if t.equalTags(Und) && strings.HasPrefix(extra, "x-") {
+ t.str = extra
+ t.pVariant = 0
+ t.pExt = 0
+ return
+ }
+ var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
+ b := buf[:t.genCoreBytes(buf[:])]
+ if extra != "" {
+ diff := len(b) - int(t.pVariant)
+ b = append(b, '-')
+ b = append(b, extra...)
+ t.pVariant = uint8(int(t.pVariant) + diff)
+ t.pExt = uint16(int(t.pExt) + diff)
+ } else {
+ t.pVariant = uint8(len(b))
+ t.pExt = uint16(len(b))
+ }
+ t.str = string(b)
+}
+
+// genCoreBytes writes a string for the base languages, script and region tags
+// to the given buffer and returns the number of bytes written. It will never
+// write more than maxCoreSize bytes.
+func (t *Tag) genCoreBytes(buf []byte) int {
+ n := t.LangID.StringToBuf(buf[:])
+ if t.ScriptID != 0 {
+ n += copy(buf[n:], "-")
+ n += copy(buf[n:], t.ScriptID.String())
+ }
+ if t.RegionID != 0 {
+ n += copy(buf[n:], "-")
+ n += copy(buf[n:], t.RegionID.String())
+ }
+ return n
+}
+
+// String returns the canonical string representation of the language tag.
+func (t Tag) String() string {
+ if t.str != "" {
+ return t.str
+ }
+ if t.ScriptID == 0 && t.RegionID == 0 {
+ return t.LangID.String()
+ }
+ buf := [maxCoreSize]byte{}
+ return string(buf[:t.genCoreBytes(buf[:])])
+}
+
+// MarshalText implements encoding.TextMarshaler.
+func (t Tag) MarshalText() (text []byte, err error) {
+ if t.str != "" {
+ text = append(text, t.str...)
+ } else if t.ScriptID == 0 && t.RegionID == 0 {
+ text = append(text, t.LangID.String()...)
+ } else {
+ buf := [maxCoreSize]byte{}
+ text = buf[:t.genCoreBytes(buf[:])]
+ }
+ return text, nil
+}
+
+// UnmarshalText implements encoding.TextUnmarshaler.
+func (t *Tag) UnmarshalText(text []byte) error {
+ tag, err := Parse(string(text))
+ *t = tag
+ return err
+}
+
+// Variants returns the part of the tag holding all variants or the empty string
+// if there are no variants defined.
+func (t Tag) Variants() string {
+ if t.pVariant == 0 {
+ return ""
+ }
+ return t.str[t.pVariant:t.pExt]
+}
+
+// VariantOrPrivateUseTags returns variants or private use tags.
+func (t Tag) VariantOrPrivateUseTags() string {
+ if t.pExt > 0 {
+ return t.str[t.pVariant:t.pExt]
+ }
+ return t.str[t.pVariant:]
+}
+
+// HasString reports whether this tag defines more than just the raw
+// components.
+func (t Tag) HasString() bool {
+ return t.str != ""
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+func (t Tag) Parent() Tag {
+ if t.str != "" {
+ // Strip the variants and extensions.
+ b, s, r := t.Raw()
+ t = Tag{LangID: b, ScriptID: s, RegionID: r}
+ if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 {
+ base, _ := addTags(Tag{LangID: t.LangID})
+ if base.ScriptID == t.ScriptID {
+ return Tag{LangID: t.LangID}
+ }
+ }
+ return t
+ }
+ if t.LangID != 0 {
+ if t.RegionID != 0 {
+ maxScript := t.ScriptID
+ if maxScript == 0 {
+ max, _ := addTags(t)
+ maxScript = max.ScriptID
+ }
+
+ for i := range parents {
+ if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript {
+ for _, r := range parents[i].fromRegion {
+ if Region(r) == t.RegionID {
+ return Tag{
+ LangID: t.LangID,
+ ScriptID: Script(parents[i].script),
+ RegionID: Region(parents[i].toRegion),
+ }
+ }
+ }
+ }
+ }
+
+ // Strip the script if it is the default one.
+ base, _ := addTags(Tag{LangID: t.LangID})
+ if base.ScriptID != maxScript {
+ return Tag{LangID: t.LangID, ScriptID: maxScript}
+ }
+ return Tag{LangID: t.LangID}
+ } else if t.ScriptID != 0 {
+ // The parent for an base-script pair with a non-default script is
+ // "und" instead of the base language.
+ base, _ := addTags(Tag{LangID: t.LangID})
+ if base.ScriptID != t.ScriptID {
+ return Und
+ }
+ return Tag{LangID: t.LangID}
+ }
+ }
+ return Und
+}
+
+// ParseExtension parses s as an extension and returns it on success.
+func ParseExtension(s string) (ext string, err error) {
+ scan := makeScannerString(s)
+ var end int
+ if n := len(scan.token); n != 1 {
+ return "", ErrSyntax
+ }
+ scan.toLower(0, len(scan.b))
+ end = parseExtension(&scan)
+ if end != len(s) {
+ return "", ErrSyntax
+ }
+ return string(scan.b), nil
+}
+
+// HasVariants reports whether t has variants.
+func (t Tag) HasVariants() bool {
+ return uint16(t.pVariant) < t.pExt
+}
+
+// HasExtensions reports whether t has extensions.
+func (t Tag) HasExtensions() bool {
+ return int(t.pExt) < len(t.str)
+}
+
+// Extension returns the extension of type x for tag t. It will return
+// false for ok if t does not have the requested extension. The returned
+// extension will be invalid in this case.
+func (t Tag) Extension(x byte) (ext string, ok bool) {
+ for i := int(t.pExt); i < len(t.str)-1; {
+ var ext string
+ i, ext = getExtension(t.str, i)
+ if ext[0] == x {
+ return ext, true
+ }
+ }
+ return "", false
+}
+
+// Extensions returns all extensions of t.
+func (t Tag) Extensions() []string {
+ e := []string{}
+ for i := int(t.pExt); i < len(t.str)-1; {
+ var ext string
+ i, ext = getExtension(t.str, i)
+ e = append(e, ext)
+ }
+ return e
+}
+
+// TypeForKey returns the type associated with the given key, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// TypeForKey will traverse the inheritance chain to get the correct value.
+func (t Tag) TypeForKey(key string) string {
+ if start, end, _ := t.findTypeForKey(key); end != start {
+ return t.str[start:end]
+ }
+ return ""
+}
+
+var (
+ errPrivateUse = errors.New("cannot set a key on a private use tag")
+ errInvalidArguments = errors.New("invalid key or type")
+)
+
+// SetTypeForKey returns a new Tag with the key set to type, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// An empty value removes an existing pair with the same key.
+func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
+ if t.IsPrivateUse() {
+ return t, errPrivateUse
+ }
+ if len(key) != 2 {
+ return t, errInvalidArguments
+ }
+
+ // Remove the setting if value is "".
+ if value == "" {
+ start, end, _ := t.findTypeForKey(key)
+ if start != end {
+ // Remove key tag and leading '-'.
+ start -= 4
+
+ // Remove a possible empty extension.
+ if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' {
+ start -= 2
+ }
+ if start == int(t.pVariant) && end == len(t.str) {
+ t.str = ""
+ t.pVariant, t.pExt = 0, 0
+ } else {
+ t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
+ }
+ }
+ return t, nil
+ }
+
+ if len(value) < 3 || len(value) > 8 {
+ return t, errInvalidArguments
+ }
+
+ var (
+ buf [maxCoreSize + maxSimpleUExtensionSize]byte
+ uStart int // start of the -u extension.
+ )
+
+ // Generate the tag string if needed.
+ if t.str == "" {
+ uStart = t.genCoreBytes(buf[:])
+ buf[uStart] = '-'
+ uStart++
+ }
+
+ // Create new key-type pair and parse it to verify.
+ b := buf[uStart:]
+ copy(b, "u-")
+ copy(b[2:], key)
+ b[4] = '-'
+ b = b[:5+copy(b[5:], value)]
+ scan := makeScanner(b)
+ if parseExtensions(&scan); scan.err != nil {
+ return t, scan.err
+ }
+
+ // Assemble the replacement string.
+ if t.str == "" {
+ t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
+ t.str = string(buf[:uStart+len(b)])
+ } else {
+ s := t.str
+ start, end, hasExt := t.findTypeForKey(key)
+ if start == end {
+ if hasExt {
+ b = b[2:]
+ }
+ t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:])
+ } else {
+ t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:])
+ }
+ }
+ return t, nil
+}
+
+// findKeyAndType returns the start and end position for the type corresponding
+// to key or the point at which to insert the key-value pair if the type
+// wasn't found. The hasExt return value reports whether an -u extension was present.
+// Note: the extensions are typically very small and are likely to contain
+// only one key-type pair.
+func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) {
+ p := int(t.pExt)
+ if len(key) != 2 || p == len(t.str) || p == 0 {
+ return p, p, false
+ }
+ s := t.str
+
+ // Find the correct extension.
+ for p++; s[p] != 'u'; p++ {
+ if s[p] > 'u' {
+ p--
+ return p, p, false
+ }
+ if p = nextExtension(s, p); p == len(s) {
+ return len(s), len(s), false
+ }
+ }
+ // Proceed to the hyphen following the extension name.
+ p++
+
+ // curKey is the key currently being processed.
+ curKey := ""
+
+ // Iterate over keys until we get the end of a section.
+ for {
+ // p points to the hyphen preceding the current token.
+ if p3 := p + 3; s[p3] == '-' {
+ // Found a key.
+ // Check whether we just processed the key that was requested.
+ if curKey == key {
+ return start, p, true
+ }
+ // Set to the next key and continue scanning type tokens.
+ curKey = s[p+1 : p3]
+ if curKey > key {
+ return p, p, true
+ }
+ // Start of the type token sequence.
+ start = p + 4
+ // A type is at least 3 characters long.
+ p += 7 // 4 + 3
+ } else {
+ // Attribute or type, which is at least 3 characters long.
+ p += 4
+ }
+ // p points past the third character of a type or attribute.
+ max := p + 5 // maximum length of token plus hyphen.
+ if len(s) < max {
+ max = len(s)
+ }
+ for ; p < max && s[p] != '-'; p++ {
+ }
+ // Bail if we have exhausted all tokens or if the next token starts
+ // a new extension.
+ if p == len(s) || s[p+2] == '-' {
+ if curKey == key {
+ return start, p, true
+ }
+ return p, p, true
+ }
+ }
+}
+
+// ParseBase parses a 2- or 3-letter ISO 639 code.
+// It returns a ValueError if s is a well-formed but unknown language identifier
+// or another error if another error occurred.
+func ParseBase(s string) (Language, error) {
+ if n := len(s); n < 2 || 3 < n {
+ return 0, ErrSyntax
+ }
+ var buf [3]byte
+ return getLangID(buf[:copy(buf[:], s)])
+}
+
+// ParseScript parses a 4-letter ISO 15924 code.
+// It returns a ValueError if s is a well-formed but unknown script identifier
+// or another error if another error occurred.
+func ParseScript(s string) (Script, error) {
+ if len(s) != 4 {
+ return 0, ErrSyntax
+ }
+ var buf [4]byte
+ return getScriptID(script, buf[:copy(buf[:], s)])
+}
+
+// EncodeM49 returns the Region for the given UN M.49 code.
+// It returns an error if r is not a valid code.
+func EncodeM49(r int) (Region, error) {
+ return getRegionM49(r)
+}
+
+// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code.
+// It returns a ValueError if s is a well-formed but unknown region identifier
+// or another error if another error occurred.
+func ParseRegion(s string) (Region, error) {
+ if n := len(s); n < 2 || 3 < n {
+ return 0, ErrSyntax
+ }
+ var buf [3]byte
+ return getRegionID(buf[:copy(buf[:], s)])
+}
+
+// IsCountry returns whether this region is a country or autonomous area. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsCountry() bool {
+ if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK {
+ return false
+ }
+ return true
+}
+
+// IsGroup returns whether this region defines a collection of regions. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsGroup() bool {
+ if r == 0 {
+ return false
+ }
+ return int(regionInclusion[r]) < len(regionContainment)
+}
+
+// Contains returns whether Region c is contained by Region r. It returns true
+// if c == r.
+func (r Region) Contains(c Region) bool {
+ if r == c {
+ return true
+ }
+ g := regionInclusion[r]
+ if g >= nRegionGroups {
+ return false
+ }
+ m := regionContainment[g]
+
+ d := regionInclusion[c]
+ b := regionInclusionBits[d]
+
+ // A contained country may belong to multiple disjoint groups. Matching any
+ // of these indicates containment. If the contained region is a group, it
+ // must strictly be a subset.
+ if d >= nRegionGroups {
+ return b&m != 0
+ }
+ return b&^m == 0
+}
+
+var errNoTLD = errors.New("language: region is not a valid ccTLD")
+
+// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
+// In all other cases it returns either the region itself or an error.
+//
+// This method may return an error for a region for which there exists a
+// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The
+// region will already be canonicalized it was obtained from a Tag that was
+// obtained using any of the default methods.
+func (r Region) TLD() (Region, error) {
+ // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
+ // difference between ISO 3166-1 and IANA ccTLD.
+ if r == _GB {
+ r = _UK
+ }
+ if (r.typ() & ccTLD) == 0 {
+ return 0, errNoTLD
+ }
+ return r, nil
+}
+
+// Canonicalize returns the region or a possible replacement if the region is
+// deprecated. It will not return a replacement for deprecated regions that
+// are split into multiple regions.
+func (r Region) Canonicalize() Region {
+ if cr := normRegion(r); cr != 0 {
+ return cr
+ }
+ return r
+}
+
+// Variant represents a registered variant of a language as defined by BCP 47.
+type Variant struct {
+ ID uint8
+ str string
+}
+
+// ParseVariant parses and returns a Variant. An error is returned if s is not
+// a valid variant.
+func ParseVariant(s string) (Variant, error) {
+ s = strings.ToLower(s)
+ if id, ok := variantIndex[s]; ok {
+ return Variant{id, s}, nil
+ }
+ return Variant{}, NewValueError([]byte(s))
+}
+
+// String returns the string representation of the variant.
+func (v Variant) String() string {
+ return v.str
+}
diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go
new file mode 100644
index 00000000..6294b815
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/lookup.go
@@ -0,0 +1,412 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "bytes"
+ "fmt"
+ "sort"
+ "strconv"
+
+ "golang.org/x/text/internal/tag"
+)
+
+// findIndex tries to find the given tag in idx and returns a standardized error
+// if it could not be found.
+func findIndex(idx tag.Index, key []byte, form string) (index int, err error) {
+ if !tag.FixCase(form, key) {
+ return 0, ErrSyntax
+ }
+ i := idx.Index(key)
+ if i == -1 {
+ return 0, NewValueError(key)
+ }
+ return i, nil
+}
+
+func searchUint(imap []uint16, key uint16) int {
+ return sort.Search(len(imap), func(i int) bool {
+ return imap[i] >= key
+ })
+}
+
+type Language uint16
+
+// getLangID returns the langID of s if s is a canonical subtag
+// or langUnknown if s is not a canonical subtag.
+func getLangID(s []byte) (Language, error) {
+ if len(s) == 2 {
+ return getLangISO2(s)
+ }
+ return getLangISO3(s)
+}
+
+// TODO language normalization as well as the AliasMaps could be moved to the
+// higher level package, but it is a bit tricky to separate the generation.
+
+func (id Language) Canonicalize() (Language, AliasType) {
+ return normLang(id)
+}
+
+// mapLang returns the mapped langID of id according to mapping m.
+func normLang(id Language) (Language, AliasType) {
+ k := sort.Search(len(AliasMap), func(i int) bool {
+ return AliasMap[i].From >= uint16(id)
+ })
+ if k < len(AliasMap) && AliasMap[k].From == uint16(id) {
+ return Language(AliasMap[k].To), AliasTypes[k]
+ }
+ return id, AliasTypeUnknown
+}
+
+// getLangISO2 returns the langID for the given 2-letter ISO language code
+// or unknownLang if this does not exist.
+func getLangISO2(s []byte) (Language, error) {
+ if !tag.FixCase("zz", s) {
+ return 0, ErrSyntax
+ }
+ if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 {
+ return Language(i), nil
+ }
+ return 0, NewValueError(s)
+}
+
+const base = 'z' - 'a' + 1
+
+func strToInt(s []byte) uint {
+ v := uint(0)
+ for i := 0; i < len(s); i++ {
+ v *= base
+ v += uint(s[i] - 'a')
+ }
+ return v
+}
+
+// converts the given integer to the original ASCII string passed to strToInt.
+// len(s) must match the number of characters obtained.
+func intToStr(v uint, s []byte) {
+ for i := len(s) - 1; i >= 0; i-- {
+ s[i] = byte(v%base) + 'a'
+ v /= base
+ }
+}
+
+// getLangISO3 returns the langID for the given 3-letter ISO language code
+// or unknownLang if this does not exist.
+func getLangISO3(s []byte) (Language, error) {
+ if tag.FixCase("und", s) {
+ // first try to match canonical 3-letter entries
+ for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) {
+ if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] {
+ // We treat "und" as special and always translate it to "unspecified".
+ // Note that ZZ and Zzzz are private use and are not treated as
+ // unspecified by default.
+ id := Language(i)
+ if id == nonCanonicalUnd {
+ return 0, nil
+ }
+ return id, nil
+ }
+ }
+ if i := altLangISO3.Index(s); i != -1 {
+ return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil
+ }
+ n := strToInt(s)
+ if langNoIndex[n/8]&(1<<(n%8)) != 0 {
+ return Language(n) + langNoIndexOffset, nil
+ }
+ // Check for non-canonical uses of ISO3.
+ for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) {
+ if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] {
+ return Language(i), nil
+ }
+ }
+ return 0, NewValueError(s)
+ }
+ return 0, ErrSyntax
+}
+
+// StringToBuf writes the string to b and returns the number of bytes
+// written. cap(b) must be >= 3.
+func (id Language) StringToBuf(b []byte) int {
+ if id >= langNoIndexOffset {
+ intToStr(uint(id)-langNoIndexOffset, b[:3])
+ return 3
+ } else if id == 0 {
+ return copy(b, "und")
+ }
+ l := lang[id<<2:]
+ if l[3] == 0 {
+ return copy(b, l[:3])
+ }
+ return copy(b, l[:2])
+}
+
+// String returns the BCP 47 representation of the langID.
+// Use b as variable name, instead of id, to ensure the variable
+// used is consistent with that of Base in which this type is embedded.
+func (b Language) String() string {
+ if b == 0 {
+ return "und"
+ } else if b >= langNoIndexOffset {
+ b -= langNoIndexOffset
+ buf := [3]byte{}
+ intToStr(uint(b), buf[:])
+ return string(buf[:])
+ }
+ l := lang.Elem(int(b))
+ if l[3] == 0 {
+ return l[:3]
+ }
+ return l[:2]
+}
+
+// ISO3 returns the ISO 639-3 language code.
+func (b Language) ISO3() string {
+ if b == 0 || b >= langNoIndexOffset {
+ return b.String()
+ }
+ l := lang.Elem(int(b))
+ if l[3] == 0 {
+ return l[:3]
+ } else if l[2] == 0 {
+ return altLangISO3.Elem(int(l[3]))[:3]
+ }
+ // This allocation will only happen for 3-letter ISO codes
+ // that are non-canonical BCP 47 language identifiers.
+ return l[0:1] + l[2:4]
+}
+
+// IsPrivateUse reports whether this language code is reserved for private use.
+func (b Language) IsPrivateUse() bool {
+ return langPrivateStart <= b && b <= langPrivateEnd
+}
+
+// SuppressScript returns the script marked as SuppressScript in the IANA
+// language tag repository, or 0 if there is no such script.
+func (b Language) SuppressScript() Script {
+ if b < langNoIndexOffset {
+ return Script(suppressScript[b])
+ }
+ return 0
+}
+
+type Region uint16
+
+// getRegionID returns the region id for s if s is a valid 2-letter region code
+// or unknownRegion.
+func getRegionID(s []byte) (Region, error) {
+ if len(s) == 3 {
+ if isAlpha(s[0]) {
+ return getRegionISO3(s)
+ }
+ if i, err := strconv.ParseUint(string(s), 10, 10); err == nil {
+ return getRegionM49(int(i))
+ }
+ }
+ return getRegionISO2(s)
+}
+
+// getRegionISO2 returns the regionID for the given 2-letter ISO country code
+// or unknownRegion if this does not exist.
+func getRegionISO2(s []byte) (Region, error) {
+ i, err := findIndex(regionISO, s, "ZZ")
+ if err != nil {
+ return 0, err
+ }
+ return Region(i) + isoRegionOffset, nil
+}
+
+// getRegionISO3 returns the regionID for the given 3-letter ISO country code
+// or unknownRegion if this does not exist.
+func getRegionISO3(s []byte) (Region, error) {
+ if tag.FixCase("ZZZ", s) {
+ for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) {
+ if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] {
+ return Region(i) + isoRegionOffset, nil
+ }
+ }
+ for i := 0; i < len(altRegionISO3); i += 3 {
+ if tag.Compare(altRegionISO3[i:i+3], s) == 0 {
+ return Region(altRegionIDs[i/3]), nil
+ }
+ }
+ return 0, NewValueError(s)
+ }
+ return 0, ErrSyntax
+}
+
+func getRegionM49(n int) (Region, error) {
+ if 0 < n && n <= 999 {
+ const (
+ searchBits = 7
+ regionBits = 9
+ regionMask = 1<<regionBits - 1
+ )
+ idx := n >> searchBits
+ buf := fromM49[m49Index[idx]:m49Index[idx+1]]
+ val := uint16(n) << regionBits // we rely on bits shifting out
+ i := sort.Search(len(buf), func(i int) bool {
+ return buf[i] >= val
+ })
+ if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val {
+ return Region(r & regionMask), nil
+ }
+ }
+ var e ValueError
+ fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n)
+ return 0, e
+}
+
+// normRegion returns a region if r is deprecated or 0 otherwise.
+// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ).
+// TODO: consider mapping split up regions to new most populous one (like CLDR).
+func normRegion(r Region) Region {
+ m := regionOldMap
+ k := sort.Search(len(m), func(i int) bool {
+ return m[i].From >= uint16(r)
+ })
+ if k < len(m) && m[k].From == uint16(r) {
+ return Region(m[k].To)
+ }
+ return 0
+}
+
+const (
+ iso3166UserAssigned = 1 << iota
+ ccTLD
+ bcp47Region
+)
+
+func (r Region) typ() byte {
+ return regionTypes[r]
+}
+
+// String returns the BCP 47 representation for the region.
+// It returns "ZZ" for an unspecified region.
+func (r Region) String() string {
+ if r < isoRegionOffset {
+ if r == 0 {
+ return "ZZ"
+ }
+ return fmt.Sprintf("%03d", r.M49())
+ }
+ r -= isoRegionOffset
+ return regionISO.Elem(int(r))[:2]
+}
+
+// ISO3 returns the 3-letter ISO code of r.
+// Note that not all regions have a 3-letter ISO code.
+// In such cases this method returns "ZZZ".
+func (r Region) ISO3() string {
+ if r < isoRegionOffset {
+ return "ZZZ"
+ }
+ r -= isoRegionOffset
+ reg := regionISO.Elem(int(r))
+ switch reg[2] {
+ case 0:
+ return altRegionISO3[reg[3]:][:3]
+ case ' ':
+ return "ZZZ"
+ }
+ return reg[0:1] + reg[2:4]
+}
+
+// M49 returns the UN M.49 encoding of r, or 0 if this encoding
+// is not defined for r.
+func (r Region) M49() int {
+ return int(m49[r])
+}
+
+// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
+// may include private-use tags that are assigned by CLDR and used in this
+// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
+func (r Region) IsPrivateUse() bool {
+ return r.typ()&iso3166UserAssigned != 0
+}
+
+type Script uint8
+
+// getScriptID returns the script id for string s. It assumes that s
+// is of the format [A-Z][a-z]{3}.
+func getScriptID(idx tag.Index, s []byte) (Script, error) {
+ i, err := findIndex(idx, s, "Zzzz")
+ return Script(i), err
+}
+
+// String returns the script code in title case.
+// It returns "Zzzz" for an unspecified script.
+func (s Script) String() string {
+ if s == 0 {
+ return "Zzzz"
+ }
+ return script.Elem(int(s))
+}
+
+// IsPrivateUse reports whether this script code is reserved for private use.
+func (s Script) IsPrivateUse() bool {
+ return _Qaaa <= s && s <= _Qabx
+}
+
+const (
+ maxAltTaglen = len("en-US-POSIX")
+ maxLen = maxAltTaglen
+)
+
+var (
+ // grandfatheredMap holds a mapping from legacy and grandfathered tags to
+ // their base language or index to more elaborate tag.
+ grandfatheredMap = map[[maxLen]byte]int16{
+ [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban
+ [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami
+ [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn
+ [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak
+ [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon
+ [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux
+ [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo
+ [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn
+ [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao
+ [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay
+ [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu
+ [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok
+ [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn
+ [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR
+ [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL
+ [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE
+ [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu
+ [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka
+ [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan
+ [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang
+
+ // Grandfathered tags with no modern replacement will be converted as
+ // follows:
+ [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish
+ [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed
+ [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default
+ [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian
+ [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo
+ [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min
+
+ // CLDR-specific tag.
+ [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root
+ [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX"
+ }
+
+ altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102}
+
+ altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix"
+)
+
+func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) {
+ if v, ok := grandfatheredMap[s]; ok {
+ if v < 0 {
+ return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true
+ }
+ t.LangID = Language(v)
+ return t, true
+ }
+ return t, false
+}
diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go
new file mode 100644
index 00000000..75a2dbca
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/match.go
@@ -0,0 +1,226 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import "errors"
+
+type scriptRegionFlags uint8
+
+const (
+ isList = 1 << iota
+ scriptInFrom
+ regionInFrom
+)
+
+func (t *Tag) setUndefinedLang(id Language) {
+ if t.LangID == 0 {
+ t.LangID = id
+ }
+}
+
+func (t *Tag) setUndefinedScript(id Script) {
+ if t.ScriptID == 0 {
+ t.ScriptID = id
+ }
+}
+
+func (t *Tag) setUndefinedRegion(id Region) {
+ if t.RegionID == 0 || t.RegionID.Contains(id) {
+ t.RegionID = id
+ }
+}
+
+// ErrMissingLikelyTagsData indicates no information was available
+// to compute likely values of missing tags.
+var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
+
+// addLikelySubtags sets subtags to their most likely value, given the locale.
+// In most cases this means setting fields for unknown values, but in some
+// cases it may alter a value. It returns an ErrMissingLikelyTagsData error
+// if the given locale cannot be expanded.
+func (t Tag) addLikelySubtags() (Tag, error) {
+ id, err := addTags(t)
+ if err != nil {
+ return t, err
+ } else if id.equalTags(t) {
+ return t, nil
+ }
+ id.RemakeString()
+ return id, nil
+}
+
+// specializeRegion attempts to specialize a group region.
+func specializeRegion(t *Tag) bool {
+ if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+ x := likelyRegionGroup[i]
+ if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID {
+ t.RegionID = Region(x.region)
+ }
+ return true
+ }
+ return false
+}
+
+// Maximize returns a new tag with missing tags filled in.
+func (t Tag) Maximize() (Tag, error) {
+ return addTags(t)
+}
+
+func addTags(t Tag) (Tag, error) {
+ // We leave private use identifiers alone.
+ if t.IsPrivateUse() {
+ return t, nil
+ }
+ if t.ScriptID != 0 && t.RegionID != 0 {
+ if t.LangID != 0 {
+ // already fully specified
+ specializeRegion(&t)
+ return t, nil
+ }
+ // Search matches for und-script-region. Note that for these cases
+ // region will never be a group so there is no need to check for this.
+ list := likelyRegion[t.RegionID : t.RegionID+1]
+ if x := list[0]; x.flags&isList != 0 {
+ list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
+ }
+ for _, x := range list {
+ // Deviating from the spec. See match_test.go for details.
+ if Script(x.script) == t.ScriptID {
+ t.setUndefinedLang(Language(x.lang))
+ return t, nil
+ }
+ }
+ }
+ if t.LangID != 0 {
+ // Search matches for lang-script and lang-region, where lang != und.
+ if t.LangID < langNoIndexOffset {
+ x := likelyLang[t.LangID]
+ if x.flags&isList != 0 {
+ list := likelyLangList[x.region : x.region+uint16(x.script)]
+ if t.ScriptID != 0 {
+ for _, x := range list {
+ if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 {
+ t.setUndefinedRegion(Region(x.region))
+ return t, nil
+ }
+ }
+ } else if t.RegionID != 0 {
+ count := 0
+ goodScript := true
+ tt := t
+ for _, x := range list {
+ // We visit all entries for which the script was not
+ // defined, including the ones where the region was not
+ // defined. This allows for proper disambiguation within
+ // regions.
+ if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) {
+ tt.RegionID = Region(x.region)
+ tt.setUndefinedScript(Script(x.script))
+ goodScript = goodScript && tt.ScriptID == Script(x.script)
+ count++
+ }
+ }
+ if count == 1 {
+ return tt, nil
+ }
+ // Even if we fail to find a unique Region, we might have
+ // an unambiguous script.
+ if goodScript {
+ t.ScriptID = tt.ScriptID
+ }
+ }
+ }
+ }
+ } else {
+ // Search matches for und-script.
+ if t.ScriptID != 0 {
+ x := likelyScript[t.ScriptID]
+ if x.region != 0 {
+ t.setUndefinedRegion(Region(x.region))
+ t.setUndefinedLang(Language(x.lang))
+ return t, nil
+ }
+ }
+ // Search matches for und-region. If und-script-region exists, it would
+ // have been found earlier.
+ if t.RegionID != 0 {
+ if i := regionInclusion[t.RegionID]; i < nRegionGroups {
+ x := likelyRegionGroup[i]
+ if x.region != 0 {
+ t.setUndefinedLang(Language(x.lang))
+ t.setUndefinedScript(Script(x.script))
+ t.RegionID = Region(x.region)
+ }
+ } else {
+ x := likelyRegion[t.RegionID]
+ if x.flags&isList != 0 {
+ x = likelyRegionList[x.lang]
+ }
+ if x.script != 0 && x.flags != scriptInFrom {
+ t.setUndefinedLang(Language(x.lang))
+ t.setUndefinedScript(Script(x.script))
+ return t, nil
+ }
+ }
+ }
+ }
+
+ // Search matches for lang.
+ if t.LangID < langNoIndexOffset {
+ x := likelyLang[t.LangID]
+ if x.flags&isList != 0 {
+ x = likelyLangList[x.region]
+ }
+ if x.region != 0 {
+ t.setUndefinedScript(Script(x.script))
+ t.setUndefinedRegion(Region(x.region))
+ }
+ specializeRegion(&t)
+ if t.LangID == 0 {
+ t.LangID = _en // default language
+ }
+ return t, nil
+ }
+ return t, ErrMissingLikelyTagsData
+}
+
+func (t *Tag) setTagsFrom(id Tag) {
+ t.LangID = id.LangID
+ t.ScriptID = id.ScriptID
+ t.RegionID = id.RegionID
+}
+
+// minimize removes the region or script subtags from t such that
+// t.addLikelySubtags() == t.minimize().addLikelySubtags().
+func (t Tag) minimize() (Tag, error) {
+ t, err := minimizeTags(t)
+ if err != nil {
+ return t, err
+ }
+ t.RemakeString()
+ return t, nil
+}
+
+// minimizeTags mimics the behavior of the ICU 51 C implementation.
+func minimizeTags(t Tag) (Tag, error) {
+ if t.equalTags(Und) {
+ return t, nil
+ }
+ max, err := addTags(t)
+ if err != nil {
+ return t, err
+ }
+ for _, id := range [...]Tag{
+ {LangID: t.LangID},
+ {LangID: t.LangID, RegionID: t.RegionID},
+ {LangID: t.LangID, ScriptID: t.ScriptID},
+ } {
+ if x, err := addTags(id); err == nil && max.equalTags(x) {
+ t.setTagsFrom(id)
+ break
+ }
+ }
+ return t, nil
+}
diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go
new file mode 100644
index 00000000..2be83e1d
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/parse.go
@@ -0,0 +1,594 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "bytes"
+ "errors"
+ "fmt"
+ "sort"
+
+ "golang.org/x/text/internal/tag"
+)
+
+// isAlpha returns true if the byte is not a digit.
+// b must be an ASCII letter or digit.
+func isAlpha(b byte) bool {
+ return b > '9'
+}
+
+// isAlphaNum returns true if the string contains only ASCII letters or digits.
+func isAlphaNum(s []byte) bool {
+ for _, c := range s {
+ if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
+ return false
+ }
+ }
+ return true
+}
+
+// ErrSyntax is returned by any of the parsing functions when the
+// input is not well-formed, according to BCP 47.
+// TODO: return the position at which the syntax error occurred?
+var ErrSyntax = errors.New("language: tag is not well-formed")
+
+// ErrDuplicateKey is returned when a tag contains the same key twice with
+// different values in the -u section.
+var ErrDuplicateKey = errors.New("language: different values for same key in -u extension")
+
+// ValueError is returned by any of the parsing functions when the
+// input is well-formed but the respective subtag is not recognized
+// as a valid value.
+type ValueError struct {
+ v [8]byte
+}
+
+// NewValueError creates a new ValueError.
+func NewValueError(tag []byte) ValueError {
+ var e ValueError
+ copy(e.v[:], tag)
+ return e
+}
+
+func (e ValueError) tag() []byte {
+ n := bytes.IndexByte(e.v[:], 0)
+ if n == -1 {
+ n = 8
+ }
+ return e.v[:n]
+}
+
+// Error implements the error interface.
+func (e ValueError) Error() string {
+ return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
+}
+
+// Subtag returns the subtag for which the error occurred.
+func (e ValueError) Subtag() string {
+ return string(e.tag())
+}
+
+// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
+type scanner struct {
+ b []byte
+ bytes [max99thPercentileSize]byte
+ token []byte
+ start int // start position of the current token
+ end int // end position of the current token
+ next int // next point for scan
+ err error
+ done bool
+}
+
+func makeScannerString(s string) scanner {
+ scan := scanner{}
+ if len(s) <= len(scan.bytes) {
+ scan.b = scan.bytes[:copy(scan.bytes[:], s)]
+ } else {
+ scan.b = []byte(s)
+ }
+ scan.init()
+ return scan
+}
+
+// makeScanner returns a scanner using b as the input buffer.
+// b is not copied and may be modified by the scanner routines.
+func makeScanner(b []byte) scanner {
+ scan := scanner{b: b}
+ scan.init()
+ return scan
+}
+
+func (s *scanner) init() {
+ for i, c := range s.b {
+ if c == '_' {
+ s.b[i] = '-'
+ }
+ }
+ s.scan()
+}
+
+// restToLower converts the string between start and end to lower case.
+func (s *scanner) toLower(start, end int) {
+ for i := start; i < end; i++ {
+ c := s.b[i]
+ if 'A' <= c && c <= 'Z' {
+ s.b[i] += 'a' - 'A'
+ }
+ }
+}
+
+func (s *scanner) setError(e error) {
+ if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) {
+ s.err = e
+ }
+}
+
+// resizeRange shrinks or grows the array at position oldStart such that
+// a new string of size newSize can fit between oldStart and oldEnd.
+// Sets the scan point to after the resized range.
+func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
+ s.start = oldStart
+ if end := oldStart + newSize; end != oldEnd {
+ diff := end - oldEnd
+ if end < cap(s.b) {
+ b := make([]byte, len(s.b)+diff)
+ copy(b, s.b[:oldStart])
+ copy(b[end:], s.b[oldEnd:])
+ s.b = b
+ } else {
+ s.b = append(s.b[end:], s.b[oldEnd:]...)
+ }
+ s.next = end + (s.next - s.end)
+ s.end = end
+ }
+}
+
+// replace replaces the current token with repl.
+func (s *scanner) replace(repl string) {
+ s.resizeRange(s.start, s.end, len(repl))
+ copy(s.b[s.start:], repl)
+}
+
+// gobble removes the current token from the input.
+// Caller must call scan after calling gobble.
+func (s *scanner) gobble(e error) {
+ s.setError(e)
+ if s.start == 0 {
+ s.b = s.b[:+copy(s.b, s.b[s.next:])]
+ s.end = 0
+ } else {
+ s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
+ s.end = s.start - 1
+ }
+ s.next = s.start
+}
+
+// deleteRange removes the given range from s.b before the current token.
+func (s *scanner) deleteRange(start, end int) {
+ s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
+ diff := end - start
+ s.next -= diff
+ s.start -= diff
+ s.end -= diff
+}
+
+// scan parses the next token of a BCP 47 string. Tokens that are larger
+// than 8 characters or include non-alphanumeric characters result in an error
+// and are gobbled and removed from the output.
+// It returns the end position of the last token consumed.
+func (s *scanner) scan() (end int) {
+ end = s.end
+ s.token = nil
+ for s.start = s.next; s.next < len(s.b); {
+ i := bytes.IndexByte(s.b[s.next:], '-')
+ if i == -1 {
+ s.end = len(s.b)
+ s.next = len(s.b)
+ i = s.end - s.start
+ } else {
+ s.end = s.next + i
+ s.next = s.end + 1
+ }
+ token := s.b[s.start:s.end]
+ if i < 1 || i > 8 || !isAlphaNum(token) {
+ s.gobble(ErrSyntax)
+ continue
+ }
+ s.token = token
+ return end
+ }
+ if n := len(s.b); n > 0 && s.b[n-1] == '-' {
+ s.setError(ErrSyntax)
+ s.b = s.b[:len(s.b)-1]
+ }
+ s.done = true
+ return end
+}
+
+// acceptMinSize parses multiple tokens of the given size or greater.
+// It returns the end position of the last token consumed.
+func (s *scanner) acceptMinSize(min int) (end int) {
+ end = s.end
+ s.scan()
+ for ; len(s.token) >= min; s.scan() {
+ end = s.end
+ }
+ return end
+}
+
+// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
+// failed it returns an error and any part of the tag that could be parsed.
+// If parsing succeeded but an unknown value was found, it returns
+// ValueError. The Tag returned in this case is just stripped of the unknown
+// value. All other values are preserved. It accepts tags in the BCP 47 format
+// and extensions to this standard defined in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+func Parse(s string) (t Tag, err error) {
+ // TODO: consider supporting old-style locale key-value pairs.
+ if s == "" {
+ return Und, ErrSyntax
+ }
+ if len(s) <= maxAltTaglen {
+ b := [maxAltTaglen]byte{}
+ for i, c := range s {
+ // Generating invalid UTF-8 is okay as it won't match.
+ if 'A' <= c && c <= 'Z' {
+ c += 'a' - 'A'
+ } else if c == '_' {
+ c = '-'
+ }
+ b[i] = byte(c)
+ }
+ if t, ok := grandfathered(b); ok {
+ return t, nil
+ }
+ }
+ scan := makeScannerString(s)
+ return parse(&scan, s)
+}
+
+func parse(scan *scanner, s string) (t Tag, err error) {
+ t = Und
+ var end int
+ if n := len(scan.token); n <= 1 {
+ scan.toLower(0, len(scan.b))
+ if n == 0 || scan.token[0] != 'x' {
+ return t, ErrSyntax
+ }
+ end = parseExtensions(scan)
+ } else if n >= 4 {
+ return Und, ErrSyntax
+ } else { // the usual case
+ t, end = parseTag(scan)
+ if n := len(scan.token); n == 1 {
+ t.pExt = uint16(end)
+ end = parseExtensions(scan)
+ } else if end < len(scan.b) {
+ scan.setError(ErrSyntax)
+ scan.b = scan.b[:end]
+ }
+ }
+ if int(t.pVariant) < len(scan.b) {
+ if end < len(s) {
+ s = s[:end]
+ }
+ if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
+ t.str = s
+ } else {
+ t.str = string(scan.b)
+ }
+ } else {
+ t.pVariant, t.pExt = 0, 0
+ }
+ return t, scan.err
+}
+
+// parseTag parses language, script, region and variants.
+// It returns a Tag and the end position in the input that was parsed.
+func parseTag(scan *scanner) (t Tag, end int) {
+ var e error
+ // TODO: set an error if an unknown lang, script or region is encountered.
+ t.LangID, e = getLangID(scan.token)
+ scan.setError(e)
+ scan.replace(t.LangID.String())
+ langStart := scan.start
+ end = scan.scan()
+ for len(scan.token) == 3 && isAlpha(scan.token[0]) {
+ // From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
+ // to a tag of the form <extlang>.
+ lang, e := getLangID(scan.token)
+ if lang != 0 {
+ t.LangID = lang
+ copy(scan.b[langStart:], lang.String())
+ scan.b[langStart+3] = '-'
+ scan.start = langStart + 4
+ }
+ scan.gobble(e)
+ end = scan.scan()
+ }
+ if len(scan.token) == 4 && isAlpha(scan.token[0]) {
+ t.ScriptID, e = getScriptID(script, scan.token)
+ if t.ScriptID == 0 {
+ scan.gobble(e)
+ }
+ end = scan.scan()
+ }
+ if n := len(scan.token); n >= 2 && n <= 3 {
+ t.RegionID, e = getRegionID(scan.token)
+ if t.RegionID == 0 {
+ scan.gobble(e)
+ } else {
+ scan.replace(t.RegionID.String())
+ }
+ end = scan.scan()
+ }
+ scan.toLower(scan.start, len(scan.b))
+ t.pVariant = byte(end)
+ end = parseVariants(scan, end, t)
+ t.pExt = uint16(end)
+ return t, end
+}
+
+var separator = []byte{'-'}
+
+// parseVariants scans tokens as long as each token is a valid variant string.
+// Duplicate variants are removed.
+func parseVariants(scan *scanner, end int, t Tag) int {
+ start := scan.start
+ varIDBuf := [4]uint8{}
+ variantBuf := [4][]byte{}
+ varID := varIDBuf[:0]
+ variant := variantBuf[:0]
+ last := -1
+ needSort := false
+ for ; len(scan.token) >= 4; scan.scan() {
+ // TODO: measure the impact of needing this conversion and redesign
+ // the data structure if there is an issue.
+ v, ok := variantIndex[string(scan.token)]
+ if !ok {
+ // unknown variant
+ // TODO: allow user-defined variants?
+ scan.gobble(NewValueError(scan.token))
+ continue
+ }
+ varID = append(varID, v)
+ variant = append(variant, scan.token)
+ if !needSort {
+ if last < int(v) {
+ last = int(v)
+ } else {
+ needSort = true
+ // There is no legal combinations of more than 7 variants
+ // (and this is by no means a useful sequence).
+ const maxVariants = 8
+ if len(varID) > maxVariants {
+ break
+ }
+ }
+ }
+ end = scan.end
+ }
+ if needSort {
+ sort.Sort(variantsSort{varID, variant})
+ k, l := 0, -1
+ for i, v := range varID {
+ w := int(v)
+ if l == w {
+ // Remove duplicates.
+ continue
+ }
+ varID[k] = varID[i]
+ variant[k] = variant[i]
+ k++
+ l = w
+ }
+ if str := bytes.Join(variant[:k], separator); len(str) == 0 {
+ end = start - 1
+ } else {
+ scan.resizeRange(start, end, len(str))
+ copy(scan.b[scan.start:], str)
+ end = scan.end
+ }
+ }
+ return end
+}
+
+type variantsSort struct {
+ i []uint8
+ v [][]byte
+}
+
+func (s variantsSort) Len() int {
+ return len(s.i)
+}
+
+func (s variantsSort) Swap(i, j int) {
+ s.i[i], s.i[j] = s.i[j], s.i[i]
+ s.v[i], s.v[j] = s.v[j], s.v[i]
+}
+
+func (s variantsSort) Less(i, j int) bool {
+ return s.i[i] < s.i[j]
+}
+
+type bytesSort struct {
+ b [][]byte
+ n int // first n bytes to compare
+}
+
+func (b bytesSort) Len() int {
+ return len(b.b)
+}
+
+func (b bytesSort) Swap(i, j int) {
+ b.b[i], b.b[j] = b.b[j], b.b[i]
+}
+
+func (b bytesSort) Less(i, j int) bool {
+ for k := 0; k < b.n; k++ {
+ if b.b[i][k] == b.b[j][k] {
+ continue
+ }
+ return b.b[i][k] < b.b[j][k]
+ }
+ return false
+}
+
+// parseExtensions parses and normalizes the extensions in the buffer.
+// It returns the last position of scan.b that is part of any extension.
+// It also trims scan.b to remove excess parts accordingly.
+func parseExtensions(scan *scanner) int {
+ start := scan.start
+ exts := [][]byte{}
+ private := []byte{}
+ end := scan.end
+ for len(scan.token) == 1 {
+ extStart := scan.start
+ ext := scan.token[0]
+ end = parseExtension(scan)
+ extension := scan.b[extStart:end]
+ if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
+ scan.setError(ErrSyntax)
+ end = extStart
+ continue
+ } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
+ scan.b = scan.b[:end]
+ return end
+ } else if ext == 'x' {
+ private = extension
+ break
+ }
+ exts = append(exts, extension)
+ }
+ sort.Sort(bytesSort{exts, 1})
+ if len(private) > 0 {
+ exts = append(exts, private)
+ }
+ scan.b = scan.b[:start]
+ if len(exts) > 0 {
+ scan.b = append(scan.b, bytes.Join(exts, separator)...)
+ } else if start > 0 {
+ // Strip trailing '-'.
+ scan.b = scan.b[:start-1]
+ }
+ return end
+}
+
+// parseExtension parses a single extension and returns the position of
+// the extension end.
+func parseExtension(scan *scanner) int {
+ start, end := scan.start, scan.end
+ switch scan.token[0] {
+ case 'u':
+ attrStart := end
+ scan.scan()
+ for last := []byte{}; len(scan.token) > 2; scan.scan() {
+ if bytes.Compare(scan.token, last) != -1 {
+ // Attributes are unsorted. Start over from scratch.
+ p := attrStart + 1
+ scan.next = p
+ attrs := [][]byte{}
+ for scan.scan(); len(scan.token) > 2; scan.scan() {
+ attrs = append(attrs, scan.token)
+ end = scan.end
+ }
+ sort.Sort(bytesSort{attrs, 3})
+ copy(scan.b[p:], bytes.Join(attrs, separator))
+ break
+ }
+ last = scan.token
+ end = scan.end
+ }
+ var last, key []byte
+ for attrEnd := end; len(scan.token) == 2; last = key {
+ key = scan.token
+ keyEnd := scan.end
+ end = scan.acceptMinSize(3)
+ // TODO: check key value validity
+ if keyEnd == end || bytes.Compare(key, last) != 1 {
+ // We have an invalid key or the keys are not sorted.
+ // Start scanning keys from scratch and reorder.
+ p := attrEnd + 1
+ scan.next = p
+ keys := [][]byte{}
+ for scan.scan(); len(scan.token) == 2; {
+ keyStart, keyEnd := scan.start, scan.end
+ end = scan.acceptMinSize(3)
+ if keyEnd != end {
+ keys = append(keys, scan.b[keyStart:end])
+ } else {
+ scan.setError(ErrSyntax)
+ end = keyStart
+ }
+ }
+ sort.Stable(bytesSort{keys, 2})
+ if n := len(keys); n > 0 {
+ k := 0
+ for i := 1; i < n; i++ {
+ if !bytes.Equal(keys[k][:2], keys[i][:2]) {
+ k++
+ keys[k] = keys[i]
+ } else if !bytes.Equal(keys[k], keys[i]) {
+ scan.setError(ErrDuplicateKey)
+ }
+ }
+ keys = keys[:k+1]
+ }
+ reordered := bytes.Join(keys, separator)
+ if e := p + len(reordered); e < end {
+ scan.deleteRange(e, end)
+ end = e
+ }
+ copy(scan.b[p:], reordered)
+ break
+ }
+ }
+ case 't':
+ scan.scan()
+ if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
+ _, end = parseTag(scan)
+ scan.toLower(start, end)
+ }
+ for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
+ end = scan.acceptMinSize(3)
+ }
+ case 'x':
+ end = scan.acceptMinSize(1)
+ default:
+ end = scan.acceptMinSize(2)
+ }
+ return end
+}
+
+// getExtension returns the name, body and end position of the extension.
+func getExtension(s string, p int) (end int, ext string) {
+ if s[p] == '-' {
+ p++
+ }
+ if s[p] == 'x' {
+ return len(s), s[p:]
+ }
+ end = nextExtension(s, p)
+ return end, s[p:end]
+}
+
+// nextExtension finds the next extension within the string, searching
+// for the -<char>- pattern from position p.
+// In the fast majority of cases, language tags will have at most
+// one extension and extensions tend to be small.
+func nextExtension(s string, p int) int {
+ for n := len(s) - 3; p < n; {
+ if s[p] == '-' {
+ if s[p+2] == '-' {
+ return p
+ }
+ p += 3
+ } else {
+ p++
+ }
+ }
+ return len(s)
+}
diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go
new file mode 100644
index 00000000..239e2d29
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/tables.go
@@ -0,0 +1,3431 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+import "golang.org/x/text/internal/tag"
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+const NumLanguages = 8665
+
+const NumScripts = 242
+
+const NumRegions = 357
+
+type FromTo struct {
+ From uint16
+ To uint16
+}
+
+const nonCanonicalUnd = 1201
+const (
+ _af = 22
+ _am = 39
+ _ar = 58
+ _az = 88
+ _bg = 126
+ _bn = 165
+ _ca = 215
+ _cs = 250
+ _da = 257
+ _de = 269
+ _el = 310
+ _en = 313
+ _es = 318
+ _et = 320
+ _fa = 328
+ _fi = 337
+ _fil = 339
+ _fr = 350
+ _gu = 420
+ _he = 444
+ _hi = 446
+ _hr = 465
+ _hu = 469
+ _hy = 471
+ _id = 481
+ _is = 504
+ _it = 505
+ _ja = 512
+ _ka = 528
+ _kk = 578
+ _km = 586
+ _kn = 593
+ _ko = 596
+ _ky = 650
+ _lo = 696
+ _lt = 704
+ _lv = 711
+ _mk = 767
+ _ml = 772
+ _mn = 779
+ _mo = 784
+ _mr = 795
+ _ms = 799
+ _mul = 806
+ _my = 817
+ _nb = 839
+ _ne = 849
+ _nl = 871
+ _no = 879
+ _pa = 925
+ _pl = 947
+ _pt = 960
+ _ro = 988
+ _ru = 994
+ _sh = 1031
+ _si = 1036
+ _sk = 1042
+ _sl = 1046
+ _sq = 1073
+ _sr = 1074
+ _sv = 1092
+ _sw = 1093
+ _ta = 1104
+ _te = 1121
+ _th = 1131
+ _tl = 1146
+ _tn = 1152
+ _tr = 1162
+ _uk = 1198
+ _ur = 1204
+ _uz = 1212
+ _vi = 1219
+ _zh = 1321
+ _zu = 1327
+ _jbo = 515
+ _ami = 1650
+ _bnn = 2357
+ _hak = 438
+ _tlh = 14467
+ _lb = 661
+ _nv = 899
+ _pwn = 12055
+ _tao = 14188
+ _tay = 14198
+ _tsu = 14662
+ _nn = 874
+ _sfb = 13629
+ _vgt = 15701
+ _sgg = 13660
+ _cmn = 3007
+ _nan = 835
+ _hsn = 467
+)
+
+const langPrivateStart = 0x2f72
+
+const langPrivateEnd = 0x3179
+
+// lang holds an alphabetically sorted list of ISO-639 language identifiers.
+// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
+// For 2-byte language identifiers, the two successive bytes have the following meaning:
+// - if the first letter of the 2- and 3-letter ISO codes are the same:
+// the second and third letter of the 3-letter ISO code.
+// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
+// For 3-byte language identifiers the 4th byte is 0.
+const lang tag.Index = "" + // Size: 5324 bytes
+ "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" +
+ "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" +
+ "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" +
+ "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" +
+ "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" +
+ "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" +
+ "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" +
+ "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" +
+ "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" +
+ "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" +
+ "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" +
+ "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" +
+ "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" +
+ "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" +
+ "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" +
+ "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" +
+ "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" +
+ "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" +
+ "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" +
+ "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" +
+ "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" +
+ "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" +
+ "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" +
+ "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" +
+ "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" +
+ "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" +
+ "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" +
+ "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" +
+ "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" +
+ "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" +
+ "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" +
+ "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" +
+ "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" +
+ "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" +
+ "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" +
+ "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" +
+ "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" +
+ "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" +
+ "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" +
+ "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" +
+ "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" +
+ "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" +
+ "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" +
+ "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" +
+ "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" +
+ "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" +
+ "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" +
+ "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" +
+ "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" +
+ "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" +
+ "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" +
+ "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" +
+ "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" +
+ "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" +
+ "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" +
+ "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
+ "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
+ "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
+ "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
+ "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
+ "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
+ "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
+ "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
+ "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
+ "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
+ "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
+ "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
+ "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
+ "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
+ "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
+ "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
+ "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
+ "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
+ "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
+ "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
+ "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
+ "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
+ "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
+ "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
+ "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
+ "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
+ "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
+ "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
+ "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
+ "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
+ "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
+ "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
+ "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
+ "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
+ "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
+ "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
+ "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
+ "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
+ "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" +
+ "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" +
+ "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" +
+ "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" +
+ "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" +
+ "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" +
+ "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" +
+ "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" +
+ "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" +
+ "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" +
+ "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" +
+ "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" +
+ "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" +
+ "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" +
+ "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" +
+ "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" +
+ "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" +
+ "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" +
+ "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" +
+ "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" +
+ "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" +
+ "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" +
+ "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" +
+ "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" +
+ "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" +
+ "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" +
+ "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" +
+ "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" +
+ "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" +
+ "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" +
+ "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
+
+const langNoIndexOffset = 1330
+
+// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
+// in lookup tables. The language ids for these language codes are derived directly
+// from the letters and are not consecutive.
+// Size: 2197 bytes, 2197 elements
+var langNoIndex = [2197]uint8{
+ // Entry 0 - 3F
+ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
+ 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
+ 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
+ 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
+ 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
+ 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
+ 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a,
+ 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
+ // Entry 40 - 7F
+ 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
+ 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
+ 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
+ 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
+ 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
+ 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
+ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
+ 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
+ // Entry 80 - BF
+ 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff,
+ 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
+ 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
+ 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
+ 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
+ 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
+ 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
+ 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
+ // Entry C0 - FF
+ 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
+ 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56,
+ 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef,
+ 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
+ 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35,
+ 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00,
+ 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
+ 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
+ // Entry 100 - 13F
+ 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
+ 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
+ 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
+ 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
+ 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f,
+ 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
+ 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
+ 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
+ // Entry 140 - 17F
+ 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16,
+ 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
+ 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09,
+ 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
+ 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
+ 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
+ 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
+ 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03,
+ // Entry 180 - 1BF
+ 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
+ 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
+ 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
+ // Entry 1C0 - 1FF
+ 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
+ 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
+ 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
+ 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
+ 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf,
+ // Entry 200 - 23F
+ 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
+ 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
+ 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf,
+ 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3,
+ 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d,
+ 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
+ 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
+ 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
+ // Entry 240 - 27F
+ 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
+ 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0,
+ 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
+ 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
+ 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
+ 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
+ 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66,
+ // Entry 280 - 2BF
+ 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
+ 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
+ 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
+ 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+ 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
+ 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
+ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
+ 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
+ // Entry 2C0 - 2FF
+ 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
+ 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
+ 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
+ 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
+ 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
+ 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
+ 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
+ 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00,
+ // Entry 300 - 33F
+ 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
+ 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
+ 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
+ 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
+ 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
+ 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
+ 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
+ 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
+ // Entry 340 - 37F
+ 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
+ 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
+ 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
+ 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
+ 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
+ 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
+ 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f,
+ 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
+ // Entry 380 - 3BF
+ 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
+ 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
+ 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
+ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
+ 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
+ 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
+ 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
+ 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
+ // Entry 3C0 - 3FF
+ 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
+ 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
+ 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
+ 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11,
+ 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01,
+ 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10,
+ 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
+ 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
+ // Entry 400 - 43F
+ 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
+ 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
+ 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
+ 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
+ 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
+ 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
+ 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
+ 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
+ // Entry 440 - 47F
+ 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
+ 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
+ 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf,
+ 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
+ 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
+ 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd,
+ 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
+ 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4,
+ // Entry 480 - 4BF
+ 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb,
+ 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
+ 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
+ 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05,
+ 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
+ 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
+ 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
+ // Entry 4C0 - 4FF
+ 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed,
+ 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
+ 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
+ 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7,
+ 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
+ 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
+ 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
+ // Entry 500 - 53F
+ 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
+ 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
+ 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
+ 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7,
+ 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
+ 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
+ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
+ 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
+ // Entry 540 - 57F
+ 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ // Entry 580 - 5BF
+ 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
+ 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
+ 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
+ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
+ 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
+ 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
+ 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
+ 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
+ // Entry 5C0 - 5FF
+ 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
+ 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
+ 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
+ 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
+ 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20,
+ 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
+ 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
+ 0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe,
+ // Entry 600 - 63F
+ 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
+ 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
+ 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
+ 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
+ 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f,
+ 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
+ 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18,
+ 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
+ // Entry 640 - 67F
+ 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c,
+ 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
+ 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98,
+ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
+ 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4,
+ 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
+ 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
+ 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
+ // Entry 680 - 6BF
+ 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
+ 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda,
+ 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0,
+ 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
+ 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
+ 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
+ 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
+ 0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f,
+ // Entry 6C0 - 6FF
+ 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
+ 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
+ 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41,
+ 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
+ 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
+ 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
+ // Entry 700 - 73F
+ 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
+ 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
+ 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
+ 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
+ 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
+ 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 740 - 77F
+ 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
+ 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
+ 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
+ 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
+ 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55,
+ 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03,
+ 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
+ // Entry 780 - 7BF
+ 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
+ 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
+ 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
+ 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
+ 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41,
+ 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
+ 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
+ 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
+ // Entry 7C0 - 7FF
+ 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42,
+ 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56,
+ 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
+ 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
+ 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
+ 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
+ 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
+ 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
+ // Entry 800 - 83F
+ 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
+ 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
+ 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
+ 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
+ 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
+ 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
+ 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
+ 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
+ // Entry 840 - 87F
+ 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
+ 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
+ 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
+ 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1,
+ 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
+ 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
+ 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
+ // Entry 880 - 8BF
+ 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
+ 0x0a, 0x00, 0x80, 0x00, 0x00,
+}
+
+// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
+// to 2-letter language codes that cannot be derived using the method described above.
+// Each 3-letter code is followed by its 1-byte langID.
+const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
+
+// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
+// Size: 12 bytes, 6 elements
+var altLangIndex = [6]uint16{
+ 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208,
+}
+
+// AliasMap maps langIDs to their suggested replacements.
+// Size: 656 bytes, 164 elements
+var AliasMap = [164]FromTo{
+ 0: {From: 0x82, To: 0x88},
+ 1: {From: 0x187, To: 0x1ae},
+ 2: {From: 0x1f3, To: 0x1e1},
+ 3: {From: 0x1fb, To: 0x1bc},
+ 4: {From: 0x208, To: 0x512},
+ 5: {From: 0x20f, To: 0x20e},
+ 6: {From: 0x310, To: 0x3dc},
+ 7: {From: 0x347, To: 0x36f},
+ 8: {From: 0x407, To: 0x432},
+ 9: {From: 0x47a, To: 0x153},
+ 10: {From: 0x490, To: 0x451},
+ 11: {From: 0x4a2, To: 0x21},
+ 12: {From: 0x53e, To: 0x544},
+ 13: {From: 0x58f, To: 0x12d},
+ 14: {From: 0x630, To: 0x1eb1},
+ 15: {From: 0x651, To: 0x431},
+ 16: {From: 0x662, To: 0x431},
+ 17: {From: 0x6ed, To: 0x3a},
+ 18: {From: 0x6f8, To: 0x1d7},
+ 19: {From: 0x73e, To: 0x21a1},
+ 20: {From: 0x7b3, To: 0x56},
+ 21: {From: 0x7b9, To: 0x299b},
+ 22: {From: 0x7c5, To: 0x58},
+ 23: {From: 0x7e6, To: 0x145},
+ 24: {From: 0x80c, To: 0x5a},
+ 25: {From: 0x815, To: 0x8d},
+ 26: {From: 0x87e, To: 0x810},
+ 27: {From: 0x8c3, To: 0xee3},
+ 28: {From: 0x9ef, To: 0x331},
+ 29: {From: 0xa36, To: 0x2c5},
+ 30: {From: 0xa3d, To: 0xbf},
+ 31: {From: 0xabe, To: 0x3322},
+ 32: {From: 0xb38, To: 0x529},
+ 33: {From: 0xb75, To: 0x265a},
+ 34: {From: 0xb7e, To: 0xbc3},
+ 35: {From: 0xb9b, To: 0x44e},
+ 36: {From: 0xbbc, To: 0x4229},
+ 37: {From: 0xbbf, To: 0x529},
+ 38: {From: 0xbfe, To: 0x2da7},
+ 39: {From: 0xc2e, To: 0x3181},
+ 40: {From: 0xcb9, To: 0xf3},
+ 41: {From: 0xd08, To: 0xfa},
+ 42: {From: 0xdc8, To: 0x11a},
+ 43: {From: 0xdd7, To: 0x32d},
+ 44: {From: 0xdf8, To: 0xdfb},
+ 45: {From: 0xdfe, To: 0x531},
+ 46: {From: 0xedf, To: 0x205a},
+ 47: {From: 0xeee, To: 0x2e9a},
+ 48: {From: 0xf39, To: 0x367},
+ 49: {From: 0x10d0, To: 0x140},
+ 50: {From: 0x1104, To: 0x2d0},
+ 51: {From: 0x11a0, To: 0x1ec},
+ 52: {From: 0x1279, To: 0x21},
+ 53: {From: 0x1424, To: 0x15e},
+ 54: {From: 0x1470, To: 0x14e},
+ 55: {From: 0x151f, To: 0xd9b},
+ 56: {From: 0x1523, To: 0x390},
+ 57: {From: 0x1532, To: 0x19f},
+ 58: {From: 0x1580, To: 0x210},
+ 59: {From: 0x1583, To: 0x10d},
+ 60: {From: 0x15a3, To: 0x3caf},
+ 61: {From: 0x166a, To: 0x19b},
+ 62: {From: 0x16c8, To: 0x136},
+ 63: {From: 0x1700, To: 0x29f8},
+ 64: {From: 0x1718, To: 0x194},
+ 65: {From: 0x1727, To: 0xf3f},
+ 66: {From: 0x177a, To: 0x178},
+ 67: {From: 0x1809, To: 0x17b6},
+ 68: {From: 0x1816, To: 0x18f3},
+ 69: {From: 0x188a, To: 0x436},
+ 70: {From: 0x1979, To: 0x1d01},
+ 71: {From: 0x1a74, To: 0x2bb0},
+ 72: {From: 0x1a8a, To: 0x1f8},
+ 73: {From: 0x1b5a, To: 0x1fa},
+ 74: {From: 0x1b86, To: 0x1515},
+ 75: {From: 0x1d64, To: 0x2c9b},
+ 76: {From: 0x2038, To: 0x37b1},
+ 77: {From: 0x203d, To: 0x20dd},
+ 78: {From: 0x205a, To: 0x30b},
+ 79: {From: 0x20e3, To: 0x274},
+ 80: {From: 0x20ee, To: 0x263},
+ 81: {From: 0x20f2, To: 0x22d},
+ 82: {From: 0x20f9, To: 0x256},
+ 83: {From: 0x210f, To: 0x21eb},
+ 84: {From: 0x2135, To: 0x27d},
+ 85: {From: 0x2160, To: 0x913},
+ 86: {From: 0x2199, To: 0x121},
+ 87: {From: 0x21ce, To: 0x1561},
+ 88: {From: 0x21e6, To: 0x504},
+ 89: {From: 0x21f4, To: 0x49f},
+ 90: {From: 0x222d, To: 0x121},
+ 91: {From: 0x2237, To: 0x121},
+ 92: {From: 0x2262, To: 0x92a},
+ 93: {From: 0x2316, To: 0x3226},
+ 94: {From: 0x2382, To: 0x3365},
+ 95: {From: 0x2472, To: 0x2c7},
+ 96: {From: 0x24e4, To: 0x2ff},
+ 97: {From: 0x24f0, To: 0x2fa},
+ 98: {From: 0x24fa, To: 0x31f},
+ 99: {From: 0x2550, To: 0xb5b},
+ 100: {From: 0x25a9, To: 0xe2},
+ 101: {From: 0x263e, To: 0x2d0},
+ 102: {From: 0x26c9, To: 0x26b4},
+ 103: {From: 0x26f9, To: 0x3c8},
+ 104: {From: 0x2727, To: 0x3caf},
+ 105: {From: 0x2765, To: 0x26b4},
+ 106: {From: 0x2789, To: 0x4358},
+ 107: {From: 0x28ef, To: 0x2837},
+ 108: {From: 0x2914, To: 0x351},
+ 109: {From: 0x2986, To: 0x2da7},
+ 110: {From: 0x2b1a, To: 0x38d},
+ 111: {From: 0x2bfc, To: 0x395},
+ 112: {From: 0x2c3f, To: 0x3caf},
+ 113: {From: 0x2cfc, To: 0x3be},
+ 114: {From: 0x2d13, To: 0x597},
+ 115: {From: 0x2d47, To: 0x148},
+ 116: {From: 0x2d48, To: 0x148},
+ 117: {From: 0x2dff, To: 0x2f1},
+ 118: {From: 0x2e08, To: 0x19cc},
+ 119: {From: 0x2e1a, To: 0x2d95},
+ 120: {From: 0x2e21, To: 0x292},
+ 121: {From: 0x2e54, To: 0x7d},
+ 122: {From: 0x2e65, To: 0x2282},
+ 123: {From: 0x2ea0, To: 0x2e9b},
+ 124: {From: 0x2eef, To: 0x2ed7},
+ 125: {From: 0x3193, To: 0x3c4},
+ 126: {From: 0x3366, To: 0x338e},
+ 127: {From: 0x342a, To: 0x3dc},
+ 128: {From: 0x34ee, To: 0x18d0},
+ 129: {From: 0x35c8, To: 0x2c9b},
+ 130: {From: 0x35e6, To: 0x412},
+ 131: {From: 0x3658, To: 0x246},
+ 132: {From: 0x3676, To: 0x3f4},
+ 133: {From: 0x36fd, To: 0x445},
+ 134: {From: 0x37c0, To: 0x121},
+ 135: {From: 0x3816, To: 0x38f2},
+ 136: {From: 0x382b, To: 0x2c9b},
+ 137: {From: 0x382f, To: 0xa9},
+ 138: {From: 0x3832, To: 0x3228},
+ 139: {From: 0x386c, To: 0x39a6},
+ 140: {From: 0x3892, To: 0x3fc0},
+ 141: {From: 0x38a5, To: 0x39d7},
+ 142: {From: 0x38b4, To: 0x1fa4},
+ 143: {From: 0x38b5, To: 0x2e9a},
+ 144: {From: 0x395c, To: 0x47e},
+ 145: {From: 0x3b4e, To: 0xd91},
+ 146: {From: 0x3b78, To: 0x137},
+ 147: {From: 0x3c99, To: 0x4bc},
+ 148: {From: 0x3fbd, To: 0x100},
+ 149: {From: 0x4208, To: 0xa91},
+ 150: {From: 0x42be, To: 0x573},
+ 151: {From: 0x42f9, To: 0x3f60},
+ 152: {From: 0x4378, To: 0x25a},
+ 153: {From: 0x43cb, To: 0x36cb},
+ 154: {From: 0x43cd, To: 0x10f},
+ 155: {From: 0x44af, To: 0x3322},
+ 156: {From: 0x44e3, To: 0x512},
+ 157: {From: 0x45ca, To: 0x2409},
+ 158: {From: 0x45dd, To: 0x26dc},
+ 159: {From: 0x4610, To: 0x48ae},
+ 160: {From: 0x46ae, To: 0x46a0},
+ 161: {From: 0x473e, To: 0x4745},
+ 162: {From: 0x4916, To: 0x31f},
+ 163: {From: 0x49a7, To: 0x523},
+}
+
+// Size: 164 bytes, 164 elements
+var AliasTypes = [164]AliasType{
+ // Entry 0 - 3F
+ 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
+ 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0,
+ 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0,
+ 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0,
+ // Entry 40 - 7F
+ 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1,
+ 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1,
+ 2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1,
+ 0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2,
+ // Entry 80 - BF
+ 0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0,
+ 1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0,
+ 0, 1, 1, 1,
+}
+
+const (
+ _Latn = 87
+ _Hani = 54
+ _Hans = 56
+ _Hant = 57
+ _Qaaa = 139
+ _Qaai = 147
+ _Qabx = 188
+ _Zinh = 236
+ _Zyyy = 241
+ _Zzzz = 242
+)
+
+// script is an alphabetically sorted list of ISO 15924 codes. The index
+// of the script in the string, divided by 4, is the internal scriptID.
+const script tag.Index = "" + // Size: 976 bytes
+ "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
+ "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" +
+ "DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" +
+ "HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" +
+ "KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" +
+ "LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" +
+ "ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" +
+ "OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" +
+ "QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" +
+ "QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" +
+ "QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" +
+ "ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" +
+ "TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" +
+ "YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
+
+// suppressScript is an index from langID to the dominant script for that language,
+// if it exists. If a script is given, it should be suppressed from the language tag.
+// Size: 1330 bytes, 1330 elements
+var suppressScript = [1330]uint8{
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 40 - 7F
+ 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
+ // Entry 80 - BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry C0 - FF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 100 - 13F
+ 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00,
+ // Entry 140 - 17F
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 180 - 1BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00,
+ // Entry 1C0 - 1FF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00,
+ // Entry 200 - 23F
+ 0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 240 - 27F
+ 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 280 - 2BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 2C0 - 2FF
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f,
+ // Entry 300 - 33F
+ 0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ // Entry 340 - 37F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 380 - 3BF
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
+ // Entry 3C0 - 3FF
+ 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 400 - 43F
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ // Entry 440 - 47F
+ 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+ // Entry 480 - 4BF
+ 0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 4C0 - 4FF
+ 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 500 - 53F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
+ 0x00, 0x00,
+}
+
+const (
+ _001 = 1
+ _419 = 31
+ _BR = 65
+ _CA = 73
+ _ES = 110
+ _GB = 123
+ _MD = 188
+ _PT = 238
+ _UK = 306
+ _US = 309
+ _ZZ = 357
+ _XA = 323
+ _XC = 325
+ _XK = 333
+)
+
+// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
+// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
+// the UN.M49 codes used for groups.)
+const isoRegionOffset = 32
+
+// regionTypes defines the status of a region for various standards.
+// Size: 358 bytes, 358 elements
+var regionTypes = [358]uint8{
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry 40 - 7F
+ 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04,
+ 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
+ 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
+ 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+ 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry 80 - BF
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry C0 - FF
+ 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+ 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06,
+ 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
+ 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+ // Entry 100 - 13F
+ 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06,
+ 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
+ // Entry 140 - 17F
+ 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
+ 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06,
+ 0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
+}
+
+// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
+// Each 2-letter codes is followed by two bytes with the following meaning:
+// - [A-Z}{2}: the first letter of the 2-letter code plus these two
+// letters form the 3-letter ISO code.
+// - 0, n: index into altRegionISO3.
+const regionISO tag.Index = "" + // Size: 1308 bytes
+ "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
+ "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
+ "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
+ "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
+ "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" +
+ "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
+ "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" +
+ "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
+ "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
+ "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
+ "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
+ "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
+ "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
+ "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
+ "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
+ "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
+ "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
+ "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
+ "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
+ "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
+
+// altRegionISO3 holds a list of 3-letter region codes that cannot be
+// mapped to 2-letter codes using the default algorithm. This is a short list.
+const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
+
+// altRegionIDs holds a list of regionIDs the positions of which match those
+// of the 3-letter ISO codes in altRegionISO3.
+// Size: 22 bytes, 11 elements
+var altRegionIDs = [11]uint16{
+ 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105,
+ 0x0121, 0x015f, 0x00dc,
+}
+
+// Size: 80 bytes, 20 elements
+var regionOldMap = [20]FromTo{
+ 0: {From: 0x44, To: 0xc4},
+ 1: {From: 0x58, To: 0xa7},
+ 2: {From: 0x5f, To: 0x60},
+ 3: {From: 0x66, To: 0x3b},
+ 4: {From: 0x79, To: 0x78},
+ 5: {From: 0x93, To: 0x37},
+ 6: {From: 0xa3, To: 0x133},
+ 7: {From: 0xc1, To: 0x133},
+ 8: {From: 0xd7, To: 0x13f},
+ 9: {From: 0xdc, To: 0x2b},
+ 10: {From: 0xef, To: 0x133},
+ 11: {From: 0xf2, To: 0xe2},
+ 12: {From: 0xfc, To: 0x70},
+ 13: {From: 0x103, To: 0x164},
+ 14: {From: 0x12a, To: 0x126},
+ 15: {From: 0x132, To: 0x7b},
+ 16: {From: 0x13a, To: 0x13e},
+ 17: {From: 0x141, To: 0x133},
+ 18: {From: 0x15d, To: 0x15e},
+ 19: {From: 0x163, To: 0x4b},
+}
+
+// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
+// codes indicating collections of regions.
+// Size: 716 bytes, 358 elements
+var m49 = [358]int16{
+ // Entry 0 - 3F
+ 0, 1, 2, 3, 5, 9, 11, 13,
+ 14, 15, 17, 18, 19, 21, 29, 30,
+ 34, 35, 39, 53, 54, 57, 61, 142,
+ 143, 145, 150, 151, 154, 155, 202, 419,
+ 958, 0, 20, 784, 4, 28, 660, 8,
+ 51, 530, 24, 10, 32, 16, 40, 36,
+ 533, 248, 31, 70, 52, 50, 56, 854,
+ 100, 48, 108, 204, 652, 60, 96, 68,
+ // Entry 40 - 7F
+ 535, 76, 44, 64, 104, 74, 72, 112,
+ 84, 124, 166, 180, 140, 178, 756, 384,
+ 184, 152, 120, 156, 170, 0, 188, 891,
+ 296, 192, 132, 531, 162, 196, 203, 278,
+ 276, 0, 262, 208, 212, 214, 204, 12,
+ 0, 218, 233, 818, 732, 232, 724, 231,
+ 967, 0, 246, 242, 238, 583, 234, 0,
+ 250, 249, 266, 826, 308, 268, 254, 831,
+ // Entry 80 - BF
+ 288, 292, 304, 270, 324, 312, 226, 300,
+ 239, 320, 316, 624, 328, 344, 334, 340,
+ 191, 332, 348, 854, 0, 360, 372, 376,
+ 833, 356, 86, 368, 364, 352, 380, 832,
+ 388, 400, 392, 581, 404, 417, 116, 296,
+ 174, 659, 408, 410, 414, 136, 398, 418,
+ 422, 662, 438, 144, 430, 426, 440, 442,
+ 428, 434, 504, 492, 498, 499, 663, 450,
+ // Entry C0 - FF
+ 584, 581, 807, 466, 104, 496, 446, 580,
+ 474, 478, 500, 470, 480, 462, 454, 484,
+ 458, 508, 516, 540, 562, 574, 566, 548,
+ 558, 528, 578, 524, 10, 520, 536, 570,
+ 554, 512, 591, 0, 604, 258, 598, 608,
+ 586, 616, 666, 612, 630, 275, 620, 581,
+ 585, 600, 591, 634, 959, 960, 961, 962,
+ 963, 964, 965, 966, 967, 968, 969, 970,
+ // Entry 100 - 13F
+ 971, 972, 638, 716, 642, 688, 643, 646,
+ 682, 90, 690, 729, 752, 702, 654, 705,
+ 744, 703, 694, 674, 686, 706, 740, 728,
+ 678, 810, 222, 534, 760, 748, 0, 796,
+ 148, 260, 768, 764, 762, 772, 626, 795,
+ 788, 776, 626, 792, 780, 798, 158, 834,
+ 804, 800, 826, 581, 0, 840, 858, 860,
+ 336, 670, 704, 862, 92, 850, 704, 548,
+ // Entry 140 - 17F
+ 876, 581, 882, 973, 974, 975, 976, 977,
+ 978, 979, 980, 981, 982, 983, 984, 985,
+ 986, 987, 988, 989, 990, 991, 992, 993,
+ 994, 995, 996, 997, 998, 720, 887, 175,
+ 891, 710, 894, 180, 716, 999,
+}
+
+// m49Index gives indexes into fromM49 based on the three most significant bits
+// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
+// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
+// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
+// The region code is stored in the 9 lsb of the indexed value.
+// Size: 18 bytes, 9 elements
+var m49Index = [9]int16{
+ 0, 59, 108, 143, 181, 220, 259, 291,
+ 333,
+}
+
+// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
+// Size: 666 bytes, 333 elements
+var fromM49 = [333]uint16{
+ // Entry 0 - 3F
+ 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
+ 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
+ 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
+ 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
+ 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
+ 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
+ 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047,
+ 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18,
+ // Entry 40 - 7F
+ 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
+ 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d,
+ 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e,
+ 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f,
+ 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72,
+ 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a,
+ 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881,
+ 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884,
+ // Entry 80 - BF
+ 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d,
+ 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f,
+ 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac,
+ 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9,
+ 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd,
+ 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5,
+ 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd,
+ 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de,
+ // Entry C0 - FF
+ 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5,
+ 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2,
+ 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b,
+ 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c,
+ 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513,
+ 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11,
+ 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117,
+ 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e,
+ // Entry 100 - 13F
+ 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023,
+ 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2,
+ 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135,
+ 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e,
+ 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7,
+ 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff,
+ 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548,
+ 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550,
+ // Entry 140 - 17F
+ 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558,
+ 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65,
+}
+
+// Size: 1615 bytes
+var variantIndex = map[string]uint8{
+ "1606nict": 0x0,
+ "1694acad": 0x1,
+ "1901": 0x2,
+ "1959acad": 0x3,
+ "1994": 0x4d,
+ "1996": 0x4,
+ "abl1943": 0x5,
+ "akuapem": 0x6,
+ "alalc97": 0x4f,
+ "aluku": 0x7,
+ "ao1990": 0x8,
+ "arevela": 0x9,
+ "arevmda": 0xa,
+ "asante": 0xb,
+ "baku1926": 0xc,
+ "balanka": 0xd,
+ "barla": 0xe,
+ "basiceng": 0xf,
+ "bauddha": 0x10,
+ "biscayan": 0x11,
+ "biske": 0x48,
+ "bohoric": 0x12,
+ "boont": 0x13,
+ "colb1945": 0x14,
+ "cornu": 0x15,
+ "dajnko": 0x16,
+ "ekavsk": 0x17,
+ "emodeng": 0x18,
+ "fonipa": 0x50,
+ "fonnapa": 0x51,
+ "fonupa": 0x52,
+ "fonxsamp": 0x53,
+ "hepburn": 0x19,
+ "heploc": 0x4e,
+ "hognorsk": 0x1a,
+ "hsistemo": 0x1b,
+ "ijekavsk": 0x1c,
+ "itihasa": 0x1d,
+ "jauer": 0x1e,
+ "jyutping": 0x1f,
+ "kkcor": 0x20,
+ "kociewie": 0x21,
+ "kscor": 0x22,
+ "laukika": 0x23,
+ "lipaw": 0x49,
+ "luna1918": 0x24,
+ "metelko": 0x25,
+ "monoton": 0x26,
+ "ndyuka": 0x27,
+ "nedis": 0x28,
+ "newfound": 0x29,
+ "njiva": 0x4a,
+ "nulik": 0x2a,
+ "osojs": 0x4b,
+ "oxendict": 0x2b,
+ "pahawh2": 0x2c,
+ "pahawh3": 0x2d,
+ "pahawh4": 0x2e,
+ "pamaka": 0x2f,
+ "petr1708": 0x30,
+ "pinyin": 0x31,
+ "polyton": 0x32,
+ "puter": 0x33,
+ "rigik": 0x34,
+ "rozaj": 0x35,
+ "rumgr": 0x36,
+ "scotland": 0x37,
+ "scouse": 0x38,
+ "simple": 0x54,
+ "solba": 0x4c,
+ "sotav": 0x39,
+ "spanglis": 0x3a,
+ "surmiran": 0x3b,
+ "sursilv": 0x3c,
+ "sutsilv": 0x3d,
+ "tarask": 0x3e,
+ "uccor": 0x3f,
+ "ucrcor": 0x40,
+ "ulster": 0x41,
+ "unifon": 0x42,
+ "vaidika": 0x43,
+ "valencia": 0x44,
+ "vallader": 0x45,
+ "wadegile": 0x46,
+ "xsistemo": 0x47,
+}
+
+// variantNumSpecialized is the number of specialized variants in variants.
+const variantNumSpecialized = 79
+
+// nRegionGroups is the number of region groups.
+const nRegionGroups = 33
+
+type likelyLangRegion struct {
+ lang uint16
+ region uint16
+}
+
+// likelyScript is a lookup table, indexed by scriptID, for the most likely
+// languages and regions given a script.
+// Size: 976 bytes, 244 elements
+var likelyScript = [244]likelyLangRegion{
+ 1: {lang: 0x14e, region: 0x84},
+ 3: {lang: 0x2a2, region: 0x106},
+ 4: {lang: 0x1f, region: 0x99},
+ 5: {lang: 0x3a, region: 0x6b},
+ 7: {lang: 0x3b, region: 0x9c},
+ 8: {lang: 0x1d7, region: 0x28},
+ 9: {lang: 0x13, region: 0x9c},
+ 10: {lang: 0x5b, region: 0x95},
+ 11: {lang: 0x60, region: 0x52},
+ 12: {lang: 0xb9, region: 0xb4},
+ 13: {lang: 0x63, region: 0x95},
+ 14: {lang: 0xa5, region: 0x35},
+ 15: {lang: 0x3e9, region: 0x99},
+ 17: {lang: 0x529, region: 0x12e},
+ 18: {lang: 0x3b1, region: 0x99},
+ 19: {lang: 0x15e, region: 0x78},
+ 20: {lang: 0xc2, region: 0x95},
+ 21: {lang: 0x9d, region: 0xe7},
+ 22: {lang: 0xdb, region: 0x35},
+ 23: {lang: 0xf3, region: 0x49},
+ 24: {lang: 0x4f0, region: 0x12b},
+ 25: {lang: 0xe7, region: 0x13e},
+ 26: {lang: 0xe5, region: 0x135},
+ 28: {lang: 0xf1, region: 0x6b},
+ 30: {lang: 0x1a0, region: 0x5d},
+ 31: {lang: 0x3e2, region: 0x106},
+ 33: {lang: 0x1be, region: 0x99},
+ 36: {lang: 0x15e, region: 0x78},
+ 39: {lang: 0x133, region: 0x6b},
+ 40: {lang: 0x431, region: 0x27},
+ 41: {lang: 0x27, region: 0x6f},
+ 43: {lang: 0x210, region: 0x7d},
+ 44: {lang: 0xfe, region: 0x38},
+ 46: {lang: 0x19b, region: 0x99},
+ 47: {lang: 0x19e, region: 0x130},
+ 48: {lang: 0x3e9, region: 0x99},
+ 49: {lang: 0x136, region: 0x87},
+ 50: {lang: 0x1a4, region: 0x99},
+ 51: {lang: 0x39d, region: 0x99},
+ 52: {lang: 0x529, region: 0x12e},
+ 53: {lang: 0x254, region: 0xab},
+ 54: {lang: 0x529, region: 0x53},
+ 55: {lang: 0x1cb, region: 0xe7},
+ 56: {lang: 0x529, region: 0x53},
+ 57: {lang: 0x529, region: 0x12e},
+ 58: {lang: 0x2fd, region: 0x9b},
+ 59: {lang: 0x1bc, region: 0x97},
+ 60: {lang: 0x200, region: 0xa2},
+ 61: {lang: 0x1c5, region: 0x12b},
+ 62: {lang: 0x1ca, region: 0xaf},
+ 65: {lang: 0x1d5, region: 0x92},
+ 67: {lang: 0x142, region: 0x9e},
+ 68: {lang: 0x254, region: 0xab},
+ 69: {lang: 0x20e, region: 0x95},
+ 70: {lang: 0x200, region: 0xa2},
+ 72: {lang: 0x135, region: 0xc4},
+ 73: {lang: 0x200, region: 0xa2},
+ 74: {lang: 0x3bb, region: 0xe8},
+ 75: {lang: 0x24a, region: 0xa6},
+ 76: {lang: 0x3fa, region: 0x99},
+ 79: {lang: 0x251, region: 0x99},
+ 80: {lang: 0x254, region: 0xab},
+ 82: {lang: 0x88, region: 0x99},
+ 83: {lang: 0x370, region: 0x123},
+ 84: {lang: 0x2b8, region: 0xaf},
+ 89: {lang: 0x29f, region: 0x99},
+ 90: {lang: 0x2a8, region: 0x99},
+ 91: {lang: 0x28f, region: 0x87},
+ 92: {lang: 0x1a0, region: 0x87},
+ 93: {lang: 0x2ac, region: 0x53},
+ 95: {lang: 0x4f4, region: 0x12b},
+ 96: {lang: 0x4f5, region: 0x12b},
+ 97: {lang: 0x1be, region: 0x99},
+ 99: {lang: 0x337, region: 0x9c},
+ 100: {lang: 0x4f7, region: 0x53},
+ 101: {lang: 0xa9, region: 0x53},
+ 104: {lang: 0x2e8, region: 0x112},
+ 105: {lang: 0x4f8, region: 0x10b},
+ 106: {lang: 0x4f8, region: 0x10b},
+ 107: {lang: 0x304, region: 0x99},
+ 108: {lang: 0x31b, region: 0x99},
+ 109: {lang: 0x30b, region: 0x53},
+ 111: {lang: 0x31e, region: 0x35},
+ 112: {lang: 0x30e, region: 0x99},
+ 113: {lang: 0x414, region: 0xe8},
+ 114: {lang: 0x331, region: 0xc4},
+ 115: {lang: 0x4f9, region: 0x108},
+ 116: {lang: 0x3b, region: 0xa1},
+ 117: {lang: 0x353, region: 0xdb},
+ 120: {lang: 0x2d0, region: 0x84},
+ 121: {lang: 0x52a, region: 0x53},
+ 122: {lang: 0x403, region: 0x96},
+ 123: {lang: 0x3ee, region: 0x99},
+ 124: {lang: 0x39b, region: 0xc5},
+ 125: {lang: 0x395, region: 0x99},
+ 126: {lang: 0x399, region: 0x135},
+ 127: {lang: 0x429, region: 0x115},
+ 128: {lang: 0x3b, region: 0x11c},
+ 129: {lang: 0xfd, region: 0xc4},
+ 130: {lang: 0x27d, region: 0x106},
+ 131: {lang: 0x2c9, region: 0x53},
+ 132: {lang: 0x39f, region: 0x9c},
+ 133: {lang: 0x39f, region: 0x53},
+ 135: {lang: 0x3ad, region: 0xb0},
+ 137: {lang: 0x1c6, region: 0x53},
+ 138: {lang: 0x4fd, region: 0x9c},
+ 189: {lang: 0x3cb, region: 0x95},
+ 191: {lang: 0x372, region: 0x10c},
+ 192: {lang: 0x420, region: 0x97},
+ 194: {lang: 0x4ff, region: 0x15e},
+ 195: {lang: 0x3f0, region: 0x99},
+ 196: {lang: 0x45, region: 0x135},
+ 197: {lang: 0x139, region: 0x7b},
+ 198: {lang: 0x3e9, region: 0x99},
+ 200: {lang: 0x3e9, region: 0x99},
+ 201: {lang: 0x3fa, region: 0x99},
+ 202: {lang: 0x40c, region: 0xb3},
+ 203: {lang: 0x433, region: 0x99},
+ 204: {lang: 0xef, region: 0xc5},
+ 205: {lang: 0x43e, region: 0x95},
+ 206: {lang: 0x44d, region: 0x35},
+ 207: {lang: 0x44e, region: 0x9b},
+ 211: {lang: 0x45a, region: 0xe7},
+ 212: {lang: 0x11a, region: 0x99},
+ 213: {lang: 0x45e, region: 0x53},
+ 214: {lang: 0x232, region: 0x53},
+ 215: {lang: 0x450, region: 0x99},
+ 216: {lang: 0x4a5, region: 0x53},
+ 217: {lang: 0x9f, region: 0x13e},
+ 218: {lang: 0x461, region: 0x99},
+ 220: {lang: 0x528, region: 0xba},
+ 221: {lang: 0x153, region: 0xe7},
+ 222: {lang: 0x128, region: 0xcd},
+ 223: {lang: 0x46b, region: 0x123},
+ 224: {lang: 0xa9, region: 0x53},
+ 225: {lang: 0x2ce, region: 0x99},
+ 226: {lang: 0x4ad, region: 0x11c},
+ 227: {lang: 0x4be, region: 0xb4},
+ 229: {lang: 0x1ce, region: 0x99},
+ 232: {lang: 0x3a9, region: 0x9c},
+ 233: {lang: 0x22, region: 0x9b},
+ 234: {lang: 0x1ea, region: 0x53},
+ 235: {lang: 0xef, region: 0xc5},
+}
+
+type likelyScriptRegion struct {
+ region uint16
+ script uint8
+ flags uint8
+}
+
+// likelyLang is a lookup table, indexed by langID, for the most likely
+// scripts and regions given incomplete information. If more entries exist for a
+// given language, region and script are the index and size respectively
+// of the list in likelyLangList.
+// Size: 5320 bytes, 1330 elements
+var likelyLang = [1330]likelyScriptRegion{
+ 0: {region: 0x135, script: 0x57, flags: 0x0},
+ 1: {region: 0x6f, script: 0x57, flags: 0x0},
+ 2: {region: 0x165, script: 0x57, flags: 0x0},
+ 3: {region: 0x165, script: 0x57, flags: 0x0},
+ 4: {region: 0x165, script: 0x57, flags: 0x0},
+ 5: {region: 0x7d, script: 0x1f, flags: 0x0},
+ 6: {region: 0x165, script: 0x57, flags: 0x0},
+ 7: {region: 0x165, script: 0x1f, flags: 0x0},
+ 8: {region: 0x80, script: 0x57, flags: 0x0},
+ 9: {region: 0x165, script: 0x57, flags: 0x0},
+ 10: {region: 0x165, script: 0x57, flags: 0x0},
+ 11: {region: 0x165, script: 0x57, flags: 0x0},
+ 12: {region: 0x95, script: 0x57, flags: 0x0},
+ 13: {region: 0x131, script: 0x57, flags: 0x0},
+ 14: {region: 0x80, script: 0x57, flags: 0x0},
+ 15: {region: 0x165, script: 0x57, flags: 0x0},
+ 16: {region: 0x165, script: 0x57, flags: 0x0},
+ 17: {region: 0x106, script: 0x1f, flags: 0x0},
+ 18: {region: 0x165, script: 0x57, flags: 0x0},
+ 19: {region: 0x9c, script: 0x9, flags: 0x0},
+ 20: {region: 0x128, script: 0x5, flags: 0x0},
+ 21: {region: 0x165, script: 0x57, flags: 0x0},
+ 22: {region: 0x161, script: 0x57, flags: 0x0},
+ 23: {region: 0x165, script: 0x57, flags: 0x0},
+ 24: {region: 0x165, script: 0x57, flags: 0x0},
+ 25: {region: 0x165, script: 0x57, flags: 0x0},
+ 26: {region: 0x165, script: 0x57, flags: 0x0},
+ 27: {region: 0x165, script: 0x57, flags: 0x0},
+ 28: {region: 0x52, script: 0x57, flags: 0x0},
+ 29: {region: 0x165, script: 0x57, flags: 0x0},
+ 30: {region: 0x165, script: 0x57, flags: 0x0},
+ 31: {region: 0x99, script: 0x4, flags: 0x0},
+ 32: {region: 0x165, script: 0x57, flags: 0x0},
+ 33: {region: 0x80, script: 0x57, flags: 0x0},
+ 34: {region: 0x9b, script: 0xe9, flags: 0x0},
+ 35: {region: 0x165, script: 0x57, flags: 0x0},
+ 36: {region: 0x165, script: 0x57, flags: 0x0},
+ 37: {region: 0x14d, script: 0x57, flags: 0x0},
+ 38: {region: 0x106, script: 0x1f, flags: 0x0},
+ 39: {region: 0x6f, script: 0x29, flags: 0x0},
+ 40: {region: 0x165, script: 0x57, flags: 0x0},
+ 41: {region: 0x165, script: 0x57, flags: 0x0},
+ 42: {region: 0xd6, script: 0x57, flags: 0x0},
+ 43: {region: 0x165, script: 0x57, flags: 0x0},
+ 45: {region: 0x165, script: 0x57, flags: 0x0},
+ 46: {region: 0x165, script: 0x57, flags: 0x0},
+ 47: {region: 0x165, script: 0x57, flags: 0x0},
+ 48: {region: 0x165, script: 0x57, flags: 0x0},
+ 49: {region: 0x165, script: 0x57, flags: 0x0},
+ 50: {region: 0x165, script: 0x57, flags: 0x0},
+ 51: {region: 0x95, script: 0x57, flags: 0x0},
+ 52: {region: 0x165, script: 0x5, flags: 0x0},
+ 53: {region: 0x122, script: 0x5, flags: 0x0},
+ 54: {region: 0x165, script: 0x57, flags: 0x0},
+ 55: {region: 0x165, script: 0x57, flags: 0x0},
+ 56: {region: 0x165, script: 0x57, flags: 0x0},
+ 57: {region: 0x165, script: 0x57, flags: 0x0},
+ 58: {region: 0x6b, script: 0x5, flags: 0x0},
+ 59: {region: 0x0, script: 0x3, flags: 0x1},
+ 60: {region: 0x165, script: 0x57, flags: 0x0},
+ 61: {region: 0x51, script: 0x57, flags: 0x0},
+ 62: {region: 0x3f, script: 0x57, flags: 0x0},
+ 63: {region: 0x67, script: 0x5, flags: 0x0},
+ 65: {region: 0xba, script: 0x5, flags: 0x0},
+ 66: {region: 0x6b, script: 0x5, flags: 0x0},
+ 67: {region: 0x99, script: 0xe, flags: 0x0},
+ 68: {region: 0x12f, script: 0x57, flags: 0x0},
+ 69: {region: 0x135, script: 0xc4, flags: 0x0},
+ 70: {region: 0x165, script: 0x57, flags: 0x0},
+ 71: {region: 0x165, script: 0x57, flags: 0x0},
+ 72: {region: 0x6e, script: 0x57, flags: 0x0},
+ 73: {region: 0x165, script: 0x57, flags: 0x0},
+ 74: {region: 0x165, script: 0x57, flags: 0x0},
+ 75: {region: 0x49, script: 0x57, flags: 0x0},
+ 76: {region: 0x165, script: 0x57, flags: 0x0},
+ 77: {region: 0x106, script: 0x1f, flags: 0x0},
+ 78: {region: 0x165, script: 0x5, flags: 0x0},
+ 79: {region: 0x165, script: 0x57, flags: 0x0},
+ 80: {region: 0x165, script: 0x57, flags: 0x0},
+ 81: {region: 0x165, script: 0x57, flags: 0x0},
+ 82: {region: 0x99, script: 0x21, flags: 0x0},
+ 83: {region: 0x165, script: 0x57, flags: 0x0},
+ 84: {region: 0x165, script: 0x57, flags: 0x0},
+ 85: {region: 0x165, script: 0x57, flags: 0x0},
+ 86: {region: 0x3f, script: 0x57, flags: 0x0},
+ 87: {region: 0x165, script: 0x57, flags: 0x0},
+ 88: {region: 0x3, script: 0x5, flags: 0x1},
+ 89: {region: 0x106, script: 0x1f, flags: 0x0},
+ 90: {region: 0xe8, script: 0x5, flags: 0x0},
+ 91: {region: 0x95, script: 0x57, flags: 0x0},
+ 92: {region: 0xdb, script: 0x21, flags: 0x0},
+ 93: {region: 0x2e, script: 0x57, flags: 0x0},
+ 94: {region: 0x52, script: 0x57, flags: 0x0},
+ 95: {region: 0x165, script: 0x57, flags: 0x0},
+ 96: {region: 0x52, script: 0xb, flags: 0x0},
+ 97: {region: 0x165, script: 0x57, flags: 0x0},
+ 98: {region: 0x165, script: 0x57, flags: 0x0},
+ 99: {region: 0x95, script: 0x57, flags: 0x0},
+ 100: {region: 0x165, script: 0x57, flags: 0x0},
+ 101: {region: 0x52, script: 0x57, flags: 0x0},
+ 102: {region: 0x165, script: 0x57, flags: 0x0},
+ 103: {region: 0x165, script: 0x57, flags: 0x0},
+ 104: {region: 0x165, script: 0x57, flags: 0x0},
+ 105: {region: 0x165, script: 0x57, flags: 0x0},
+ 106: {region: 0x4f, script: 0x57, flags: 0x0},
+ 107: {region: 0x165, script: 0x57, flags: 0x0},
+ 108: {region: 0x165, script: 0x57, flags: 0x0},
+ 109: {region: 0x165, script: 0x57, flags: 0x0},
+ 110: {region: 0x165, script: 0x29, flags: 0x0},
+ 111: {region: 0x165, script: 0x57, flags: 0x0},
+ 112: {region: 0x165, script: 0x57, flags: 0x0},
+ 113: {region: 0x47, script: 0x1f, flags: 0x0},
+ 114: {region: 0x165, script: 0x57, flags: 0x0},
+ 115: {region: 0x165, script: 0x57, flags: 0x0},
+ 116: {region: 0x10b, script: 0x5, flags: 0x0},
+ 117: {region: 0x162, script: 0x57, flags: 0x0},
+ 118: {region: 0x165, script: 0x57, flags: 0x0},
+ 119: {region: 0x95, script: 0x57, flags: 0x0},
+ 120: {region: 0x165, script: 0x57, flags: 0x0},
+ 121: {region: 0x12f, script: 0x57, flags: 0x0},
+ 122: {region: 0x52, script: 0x57, flags: 0x0},
+ 123: {region: 0x99, script: 0xd7, flags: 0x0},
+ 124: {region: 0xe8, script: 0x5, flags: 0x0},
+ 125: {region: 0x99, script: 0x21, flags: 0x0},
+ 126: {region: 0x38, script: 0x1f, flags: 0x0},
+ 127: {region: 0x99, script: 0x21, flags: 0x0},
+ 128: {region: 0xe8, script: 0x5, flags: 0x0},
+ 129: {region: 0x12b, script: 0x31, flags: 0x0},
+ 131: {region: 0x99, script: 0x21, flags: 0x0},
+ 132: {region: 0x165, script: 0x57, flags: 0x0},
+ 133: {region: 0x99, script: 0x21, flags: 0x0},
+ 134: {region: 0xe7, script: 0x57, flags: 0x0},
+ 135: {region: 0x165, script: 0x57, flags: 0x0},
+ 136: {region: 0x99, script: 0x21, flags: 0x0},
+ 137: {region: 0x165, script: 0x57, flags: 0x0},
+ 138: {region: 0x13f, script: 0x57, flags: 0x0},
+ 139: {region: 0x165, script: 0x57, flags: 0x0},
+ 140: {region: 0x165, script: 0x57, flags: 0x0},
+ 141: {region: 0xe7, script: 0x57, flags: 0x0},
+ 142: {region: 0x165, script: 0x57, flags: 0x0},
+ 143: {region: 0xd6, script: 0x57, flags: 0x0},
+ 144: {region: 0x165, script: 0x57, flags: 0x0},
+ 145: {region: 0x165, script: 0x57, flags: 0x0},
+ 146: {region: 0x165, script: 0x57, flags: 0x0},
+ 147: {region: 0x165, script: 0x29, flags: 0x0},
+ 148: {region: 0x99, script: 0x21, flags: 0x0},
+ 149: {region: 0x95, script: 0x57, flags: 0x0},
+ 150: {region: 0x165, script: 0x57, flags: 0x0},
+ 151: {region: 0x165, script: 0x57, flags: 0x0},
+ 152: {region: 0x114, script: 0x57, flags: 0x0},
+ 153: {region: 0x165, script: 0x57, flags: 0x0},
+ 154: {region: 0x165, script: 0x57, flags: 0x0},
+ 155: {region: 0x52, script: 0x57, flags: 0x0},
+ 156: {region: 0x165, script: 0x57, flags: 0x0},
+ 157: {region: 0xe7, script: 0x57, flags: 0x0},
+ 158: {region: 0x165, script: 0x57, flags: 0x0},
+ 159: {region: 0x13e, script: 0xd9, flags: 0x0},
+ 160: {region: 0xc3, script: 0x57, flags: 0x0},
+ 161: {region: 0x165, script: 0x57, flags: 0x0},
+ 162: {region: 0x165, script: 0x57, flags: 0x0},
+ 163: {region: 0xc3, script: 0x57, flags: 0x0},
+ 164: {region: 0x165, script: 0x57, flags: 0x0},
+ 165: {region: 0x35, script: 0xe, flags: 0x0},
+ 166: {region: 0x165, script: 0x57, flags: 0x0},
+ 167: {region: 0x165, script: 0x57, flags: 0x0},
+ 168: {region: 0x165, script: 0x57, flags: 0x0},
+ 169: {region: 0x53, script: 0xe0, flags: 0x0},
+ 170: {region: 0x165, script: 0x57, flags: 0x0},
+ 171: {region: 0x165, script: 0x57, flags: 0x0},
+ 172: {region: 0x165, script: 0x57, flags: 0x0},
+ 173: {region: 0x99, script: 0xe, flags: 0x0},
+ 174: {region: 0x165, script: 0x57, flags: 0x0},
+ 175: {region: 0x9c, script: 0x5, flags: 0x0},
+ 176: {region: 0x165, script: 0x57, flags: 0x0},
+ 177: {region: 0x4f, script: 0x57, flags: 0x0},
+ 178: {region: 0x78, script: 0x57, flags: 0x0},
+ 179: {region: 0x99, script: 0x21, flags: 0x0},
+ 180: {region: 0xe8, script: 0x5, flags: 0x0},
+ 181: {region: 0x99, script: 0x21, flags: 0x0},
+ 182: {region: 0x165, script: 0x57, flags: 0x0},
+ 183: {region: 0x33, script: 0x57, flags: 0x0},
+ 184: {region: 0x165, script: 0x57, flags: 0x0},
+ 185: {region: 0xb4, script: 0xc, flags: 0x0},
+ 186: {region: 0x52, script: 0x57, flags: 0x0},
+ 187: {region: 0x165, script: 0x29, flags: 0x0},
+ 188: {region: 0xe7, script: 0x57, flags: 0x0},
+ 189: {region: 0x165, script: 0x57, flags: 0x0},
+ 190: {region: 0xe8, script: 0x21, flags: 0x0},
+ 191: {region: 0x106, script: 0x1f, flags: 0x0},
+ 192: {region: 0x15f, script: 0x57, flags: 0x0},
+ 193: {region: 0x165, script: 0x57, flags: 0x0},
+ 194: {region: 0x95, script: 0x57, flags: 0x0},
+ 195: {region: 0x165, script: 0x57, flags: 0x0},
+ 196: {region: 0x52, script: 0x57, flags: 0x0},
+ 197: {region: 0x165, script: 0x57, flags: 0x0},
+ 198: {region: 0x165, script: 0x57, flags: 0x0},
+ 199: {region: 0x165, script: 0x57, flags: 0x0},
+ 200: {region: 0x86, script: 0x57, flags: 0x0},
+ 201: {region: 0x165, script: 0x57, flags: 0x0},
+ 202: {region: 0x165, script: 0x57, flags: 0x0},
+ 203: {region: 0x165, script: 0x57, flags: 0x0},
+ 204: {region: 0x165, script: 0x57, flags: 0x0},
+ 205: {region: 0x6d, script: 0x29, flags: 0x0},
+ 206: {region: 0x165, script: 0x57, flags: 0x0},
+ 207: {region: 0x165, script: 0x57, flags: 0x0},
+ 208: {region: 0x52, script: 0x57, flags: 0x0},
+ 209: {region: 0x165, script: 0x57, flags: 0x0},
+ 210: {region: 0x165, script: 0x57, flags: 0x0},
+ 211: {region: 0xc3, script: 0x57, flags: 0x0},
+ 212: {region: 0x165, script: 0x57, flags: 0x0},
+ 213: {region: 0x165, script: 0x57, flags: 0x0},
+ 214: {region: 0x165, script: 0x57, flags: 0x0},
+ 215: {region: 0x6e, script: 0x57, flags: 0x0},
+ 216: {region: 0x165, script: 0x57, flags: 0x0},
+ 217: {region: 0x165, script: 0x57, flags: 0x0},
+ 218: {region: 0xd6, script: 0x57, flags: 0x0},
+ 219: {region: 0x35, script: 0x16, flags: 0x0},
+ 220: {region: 0x106, script: 0x1f, flags: 0x0},
+ 221: {region: 0xe7, script: 0x57, flags: 0x0},
+ 222: {region: 0x165, script: 0x57, flags: 0x0},
+ 223: {region: 0x131, script: 0x57, flags: 0x0},
+ 224: {region: 0x8a, script: 0x57, flags: 0x0},
+ 225: {region: 0x75, script: 0x57, flags: 0x0},
+ 226: {region: 0x106, script: 0x1f, flags: 0x0},
+ 227: {region: 0x135, script: 0x57, flags: 0x0},
+ 228: {region: 0x49, script: 0x57, flags: 0x0},
+ 229: {region: 0x135, script: 0x1a, flags: 0x0},
+ 230: {region: 0xa6, script: 0x5, flags: 0x0},
+ 231: {region: 0x13e, script: 0x19, flags: 0x0},
+ 232: {region: 0x165, script: 0x57, flags: 0x0},
+ 233: {region: 0x9b, script: 0x5, flags: 0x0},
+ 234: {region: 0x165, script: 0x57, flags: 0x0},
+ 235: {region: 0x165, script: 0x57, flags: 0x0},
+ 236: {region: 0x165, script: 0x57, flags: 0x0},
+ 237: {region: 0x165, script: 0x57, flags: 0x0},
+ 238: {region: 0x165, script: 0x57, flags: 0x0},
+ 239: {region: 0xc5, script: 0xcc, flags: 0x0},
+ 240: {region: 0x78, script: 0x57, flags: 0x0},
+ 241: {region: 0x6b, script: 0x1c, flags: 0x0},
+ 242: {region: 0xe7, script: 0x57, flags: 0x0},
+ 243: {region: 0x49, script: 0x17, flags: 0x0},
+ 244: {region: 0x130, script: 0x1f, flags: 0x0},
+ 245: {region: 0x49, script: 0x17, flags: 0x0},
+ 246: {region: 0x49, script: 0x17, flags: 0x0},
+ 247: {region: 0x49, script: 0x17, flags: 0x0},
+ 248: {region: 0x49, script: 0x17, flags: 0x0},
+ 249: {region: 0x10a, script: 0x57, flags: 0x0},
+ 250: {region: 0x5e, script: 0x57, flags: 0x0},
+ 251: {region: 0xe9, script: 0x57, flags: 0x0},
+ 252: {region: 0x49, script: 0x17, flags: 0x0},
+ 253: {region: 0xc4, script: 0x81, flags: 0x0},
+ 254: {region: 0x8, script: 0x2, flags: 0x1},
+ 255: {region: 0x106, script: 0x1f, flags: 0x0},
+ 256: {region: 0x7b, script: 0x57, flags: 0x0},
+ 257: {region: 0x63, script: 0x57, flags: 0x0},
+ 258: {region: 0x165, script: 0x57, flags: 0x0},
+ 259: {region: 0x165, script: 0x57, flags: 0x0},
+ 260: {region: 0x165, script: 0x57, flags: 0x0},
+ 261: {region: 0x165, script: 0x57, flags: 0x0},
+ 262: {region: 0x135, script: 0x57, flags: 0x0},
+ 263: {region: 0x106, script: 0x1f, flags: 0x0},
+ 264: {region: 0xa4, script: 0x57, flags: 0x0},
+ 265: {region: 0x165, script: 0x57, flags: 0x0},
+ 266: {region: 0x165, script: 0x57, flags: 0x0},
+ 267: {region: 0x99, script: 0x5, flags: 0x0},
+ 268: {region: 0x165, script: 0x57, flags: 0x0},
+ 269: {region: 0x60, script: 0x57, flags: 0x0},
+ 270: {region: 0x165, script: 0x57, flags: 0x0},
+ 271: {region: 0x49, script: 0x57, flags: 0x0},
+ 272: {region: 0x165, script: 0x57, flags: 0x0},
+ 273: {region: 0x165, script: 0x57, flags: 0x0},
+ 274: {region: 0x165, script: 0x57, flags: 0x0},
+ 275: {region: 0x165, script: 0x5, flags: 0x0},
+ 276: {region: 0x49, script: 0x57, flags: 0x0},
+ 277: {region: 0x165, script: 0x57, flags: 0x0},
+ 278: {region: 0x165, script: 0x57, flags: 0x0},
+ 279: {region: 0xd4, script: 0x57, flags: 0x0},
+ 280: {region: 0x4f, script: 0x57, flags: 0x0},
+ 281: {region: 0x165, script: 0x57, flags: 0x0},
+ 282: {region: 0x99, script: 0x5, flags: 0x0},
+ 283: {region: 0x165, script: 0x57, flags: 0x0},
+ 284: {region: 0x165, script: 0x57, flags: 0x0},
+ 285: {region: 0x165, script: 0x57, flags: 0x0},
+ 286: {region: 0x165, script: 0x29, flags: 0x0},
+ 287: {region: 0x60, script: 0x57, flags: 0x0},
+ 288: {region: 0xc3, script: 0x57, flags: 0x0},
+ 289: {region: 0xd0, script: 0x57, flags: 0x0},
+ 290: {region: 0x165, script: 0x57, flags: 0x0},
+ 291: {region: 0xdb, script: 0x21, flags: 0x0},
+ 292: {region: 0x52, script: 0x57, flags: 0x0},
+ 293: {region: 0x165, script: 0x57, flags: 0x0},
+ 294: {region: 0x165, script: 0x57, flags: 0x0},
+ 295: {region: 0x165, script: 0x57, flags: 0x0},
+ 296: {region: 0xcd, script: 0xde, flags: 0x0},
+ 297: {region: 0x165, script: 0x57, flags: 0x0},
+ 298: {region: 0x165, script: 0x57, flags: 0x0},
+ 299: {region: 0x114, script: 0x57, flags: 0x0},
+ 300: {region: 0x37, script: 0x57, flags: 0x0},
+ 301: {region: 0x43, script: 0xe0, flags: 0x0},
+ 302: {region: 0x165, script: 0x57, flags: 0x0},
+ 303: {region: 0xa4, script: 0x57, flags: 0x0},
+ 304: {region: 0x80, script: 0x57, flags: 0x0},
+ 305: {region: 0xd6, script: 0x57, flags: 0x0},
+ 306: {region: 0x9e, script: 0x57, flags: 0x0},
+ 307: {region: 0x6b, script: 0x27, flags: 0x0},
+ 308: {region: 0x165, script: 0x57, flags: 0x0},
+ 309: {region: 0xc4, script: 0x48, flags: 0x0},
+ 310: {region: 0x87, script: 0x31, flags: 0x0},
+ 311: {region: 0x165, script: 0x57, flags: 0x0},
+ 312: {region: 0x165, script: 0x57, flags: 0x0},
+ 313: {region: 0xa, script: 0x2, flags: 0x1},
+ 314: {region: 0x165, script: 0x57, flags: 0x0},
+ 315: {region: 0x165, script: 0x57, flags: 0x0},
+ 316: {region: 0x1, script: 0x57, flags: 0x0},
+ 317: {region: 0x165, script: 0x57, flags: 0x0},
+ 318: {region: 0x6e, script: 0x57, flags: 0x0},
+ 319: {region: 0x135, script: 0x57, flags: 0x0},
+ 320: {region: 0x6a, script: 0x57, flags: 0x0},
+ 321: {region: 0x165, script: 0x57, flags: 0x0},
+ 322: {region: 0x9e, script: 0x43, flags: 0x0},
+ 323: {region: 0x165, script: 0x57, flags: 0x0},
+ 324: {region: 0x165, script: 0x57, flags: 0x0},
+ 325: {region: 0x6e, script: 0x57, flags: 0x0},
+ 326: {region: 0x52, script: 0x57, flags: 0x0},
+ 327: {region: 0x6e, script: 0x57, flags: 0x0},
+ 328: {region: 0x9c, script: 0x5, flags: 0x0},
+ 329: {region: 0x165, script: 0x57, flags: 0x0},
+ 330: {region: 0x165, script: 0x57, flags: 0x0},
+ 331: {region: 0x165, script: 0x57, flags: 0x0},
+ 332: {region: 0x165, script: 0x57, flags: 0x0},
+ 333: {region: 0x86, script: 0x57, flags: 0x0},
+ 334: {region: 0xc, script: 0x2, flags: 0x1},
+ 335: {region: 0x165, script: 0x57, flags: 0x0},
+ 336: {region: 0xc3, script: 0x57, flags: 0x0},
+ 337: {region: 0x72, script: 0x57, flags: 0x0},
+ 338: {region: 0x10b, script: 0x5, flags: 0x0},
+ 339: {region: 0xe7, script: 0x57, flags: 0x0},
+ 340: {region: 0x10c, script: 0x57, flags: 0x0},
+ 341: {region: 0x73, script: 0x57, flags: 0x0},
+ 342: {region: 0x165, script: 0x57, flags: 0x0},
+ 343: {region: 0x165, script: 0x57, flags: 0x0},
+ 344: {region: 0x76, script: 0x57, flags: 0x0},
+ 345: {region: 0x165, script: 0x57, flags: 0x0},
+ 346: {region: 0x3b, script: 0x57, flags: 0x0},
+ 347: {region: 0x165, script: 0x57, flags: 0x0},
+ 348: {region: 0x165, script: 0x57, flags: 0x0},
+ 349: {region: 0x165, script: 0x57, flags: 0x0},
+ 350: {region: 0x78, script: 0x57, flags: 0x0},
+ 351: {region: 0x135, script: 0x57, flags: 0x0},
+ 352: {region: 0x78, script: 0x57, flags: 0x0},
+ 353: {region: 0x60, script: 0x57, flags: 0x0},
+ 354: {region: 0x60, script: 0x57, flags: 0x0},
+ 355: {region: 0x52, script: 0x5, flags: 0x0},
+ 356: {region: 0x140, script: 0x57, flags: 0x0},
+ 357: {region: 0x165, script: 0x57, flags: 0x0},
+ 358: {region: 0x84, script: 0x57, flags: 0x0},
+ 359: {region: 0x165, script: 0x57, flags: 0x0},
+ 360: {region: 0xd4, script: 0x57, flags: 0x0},
+ 361: {region: 0x9e, script: 0x57, flags: 0x0},
+ 362: {region: 0xd6, script: 0x57, flags: 0x0},
+ 363: {region: 0x165, script: 0x57, flags: 0x0},
+ 364: {region: 0x10b, script: 0x57, flags: 0x0},
+ 365: {region: 0xd9, script: 0x57, flags: 0x0},
+ 366: {region: 0x96, script: 0x57, flags: 0x0},
+ 367: {region: 0x80, script: 0x57, flags: 0x0},
+ 368: {region: 0x165, script: 0x57, flags: 0x0},
+ 369: {region: 0xbc, script: 0x57, flags: 0x0},
+ 370: {region: 0x165, script: 0x57, flags: 0x0},
+ 371: {region: 0x165, script: 0x57, flags: 0x0},
+ 372: {region: 0x165, script: 0x57, flags: 0x0},
+ 373: {region: 0x53, script: 0x38, flags: 0x0},
+ 374: {region: 0x165, script: 0x57, flags: 0x0},
+ 375: {region: 0x95, script: 0x57, flags: 0x0},
+ 376: {region: 0x165, script: 0x57, flags: 0x0},
+ 377: {region: 0x165, script: 0x57, flags: 0x0},
+ 378: {region: 0x99, script: 0x21, flags: 0x0},
+ 379: {region: 0x165, script: 0x57, flags: 0x0},
+ 380: {region: 0x9c, script: 0x5, flags: 0x0},
+ 381: {region: 0x7e, script: 0x57, flags: 0x0},
+ 382: {region: 0x7b, script: 0x57, flags: 0x0},
+ 383: {region: 0x165, script: 0x57, flags: 0x0},
+ 384: {region: 0x165, script: 0x57, flags: 0x0},
+ 385: {region: 0x165, script: 0x57, flags: 0x0},
+ 386: {region: 0x165, script: 0x57, flags: 0x0},
+ 387: {region: 0x165, script: 0x57, flags: 0x0},
+ 388: {region: 0x165, script: 0x57, flags: 0x0},
+ 389: {region: 0x6f, script: 0x29, flags: 0x0},
+ 390: {region: 0x165, script: 0x57, flags: 0x0},
+ 391: {region: 0xdb, script: 0x21, flags: 0x0},
+ 392: {region: 0x165, script: 0x57, flags: 0x0},
+ 393: {region: 0xa7, script: 0x57, flags: 0x0},
+ 394: {region: 0x165, script: 0x57, flags: 0x0},
+ 395: {region: 0xe8, script: 0x5, flags: 0x0},
+ 396: {region: 0x165, script: 0x57, flags: 0x0},
+ 397: {region: 0xe8, script: 0x5, flags: 0x0},
+ 398: {region: 0x165, script: 0x57, flags: 0x0},
+ 399: {region: 0x165, script: 0x57, flags: 0x0},
+ 400: {region: 0x6e, script: 0x57, flags: 0x0},
+ 401: {region: 0x9c, script: 0x5, flags: 0x0},
+ 402: {region: 0x165, script: 0x57, flags: 0x0},
+ 403: {region: 0x165, script: 0x29, flags: 0x0},
+ 404: {region: 0xf1, script: 0x57, flags: 0x0},
+ 405: {region: 0x165, script: 0x57, flags: 0x0},
+ 406: {region: 0x165, script: 0x57, flags: 0x0},
+ 407: {region: 0x165, script: 0x57, flags: 0x0},
+ 408: {region: 0x165, script: 0x29, flags: 0x0},
+ 409: {region: 0x165, script: 0x57, flags: 0x0},
+ 410: {region: 0x99, script: 0x21, flags: 0x0},
+ 411: {region: 0x99, script: 0xda, flags: 0x0},
+ 412: {region: 0x95, script: 0x57, flags: 0x0},
+ 413: {region: 0xd9, script: 0x57, flags: 0x0},
+ 414: {region: 0x130, script: 0x2f, flags: 0x0},
+ 415: {region: 0x165, script: 0x57, flags: 0x0},
+ 416: {region: 0xe, script: 0x2, flags: 0x1},
+ 417: {region: 0x99, script: 0xe, flags: 0x0},
+ 418: {region: 0x165, script: 0x57, flags: 0x0},
+ 419: {region: 0x4e, script: 0x57, flags: 0x0},
+ 420: {region: 0x99, script: 0x32, flags: 0x0},
+ 421: {region: 0x41, script: 0x57, flags: 0x0},
+ 422: {region: 0x54, script: 0x57, flags: 0x0},
+ 423: {region: 0x165, script: 0x57, flags: 0x0},
+ 424: {region: 0x80, script: 0x57, flags: 0x0},
+ 425: {region: 0x165, script: 0x57, flags: 0x0},
+ 426: {region: 0x165, script: 0x57, flags: 0x0},
+ 427: {region: 0xa4, script: 0x57, flags: 0x0},
+ 428: {region: 0x98, script: 0x57, flags: 0x0},
+ 429: {region: 0x165, script: 0x57, flags: 0x0},
+ 430: {region: 0xdb, script: 0x21, flags: 0x0},
+ 431: {region: 0x165, script: 0x57, flags: 0x0},
+ 432: {region: 0x165, script: 0x5, flags: 0x0},
+ 433: {region: 0x49, script: 0x57, flags: 0x0},
+ 434: {region: 0x165, script: 0x5, flags: 0x0},
+ 435: {region: 0x165, script: 0x57, flags: 0x0},
+ 436: {region: 0x10, script: 0x3, flags: 0x1},
+ 437: {region: 0x165, script: 0x57, flags: 0x0},
+ 438: {region: 0x53, script: 0x38, flags: 0x0},
+ 439: {region: 0x165, script: 0x57, flags: 0x0},
+ 440: {region: 0x135, script: 0x57, flags: 0x0},
+ 441: {region: 0x24, script: 0x5, flags: 0x0},
+ 442: {region: 0x165, script: 0x57, flags: 0x0},
+ 443: {region: 0x165, script: 0x29, flags: 0x0},
+ 444: {region: 0x97, script: 0x3b, flags: 0x0},
+ 445: {region: 0x165, script: 0x57, flags: 0x0},
+ 446: {region: 0x99, script: 0x21, flags: 0x0},
+ 447: {region: 0x165, script: 0x57, flags: 0x0},
+ 448: {region: 0x73, script: 0x57, flags: 0x0},
+ 449: {region: 0x165, script: 0x57, flags: 0x0},
+ 450: {region: 0x165, script: 0x57, flags: 0x0},
+ 451: {region: 0xe7, script: 0x57, flags: 0x0},
+ 452: {region: 0x165, script: 0x57, flags: 0x0},
+ 453: {region: 0x12b, script: 0x3d, flags: 0x0},
+ 454: {region: 0x53, script: 0x89, flags: 0x0},
+ 455: {region: 0x165, script: 0x57, flags: 0x0},
+ 456: {region: 0xe8, script: 0x5, flags: 0x0},
+ 457: {region: 0x99, script: 0x21, flags: 0x0},
+ 458: {region: 0xaf, script: 0x3e, flags: 0x0},
+ 459: {region: 0xe7, script: 0x57, flags: 0x0},
+ 460: {region: 0xe8, script: 0x5, flags: 0x0},
+ 461: {region: 0xe6, script: 0x57, flags: 0x0},
+ 462: {region: 0x99, script: 0x21, flags: 0x0},
+ 463: {region: 0x99, script: 0x21, flags: 0x0},
+ 464: {region: 0x165, script: 0x57, flags: 0x0},
+ 465: {region: 0x90, script: 0x57, flags: 0x0},
+ 466: {region: 0x60, script: 0x57, flags: 0x0},
+ 467: {region: 0x53, script: 0x38, flags: 0x0},
+ 468: {region: 0x91, script: 0x57, flags: 0x0},
+ 469: {region: 0x92, script: 0x57, flags: 0x0},
+ 470: {region: 0x165, script: 0x57, flags: 0x0},
+ 471: {region: 0x28, script: 0x8, flags: 0x0},
+ 472: {region: 0xd2, script: 0x57, flags: 0x0},
+ 473: {region: 0x78, script: 0x57, flags: 0x0},
+ 474: {region: 0x165, script: 0x57, flags: 0x0},
+ 475: {region: 0x165, script: 0x57, flags: 0x0},
+ 476: {region: 0xd0, script: 0x57, flags: 0x0},
+ 477: {region: 0xd6, script: 0x57, flags: 0x0},
+ 478: {region: 0x165, script: 0x57, flags: 0x0},
+ 479: {region: 0x165, script: 0x57, flags: 0x0},
+ 480: {region: 0x165, script: 0x57, flags: 0x0},
+ 481: {region: 0x95, script: 0x57, flags: 0x0},
+ 482: {region: 0x165, script: 0x57, flags: 0x0},
+ 483: {region: 0x165, script: 0x57, flags: 0x0},
+ 484: {region: 0x165, script: 0x57, flags: 0x0},
+ 486: {region: 0x122, script: 0x57, flags: 0x0},
+ 487: {region: 0xd6, script: 0x57, flags: 0x0},
+ 488: {region: 0x165, script: 0x57, flags: 0x0},
+ 489: {region: 0x165, script: 0x57, flags: 0x0},
+ 490: {region: 0x53, script: 0xea, flags: 0x0},
+ 491: {region: 0x165, script: 0x57, flags: 0x0},
+ 492: {region: 0x135, script: 0x57, flags: 0x0},
+ 493: {region: 0x165, script: 0x57, flags: 0x0},
+ 494: {region: 0x49, script: 0x57, flags: 0x0},
+ 495: {region: 0x165, script: 0x57, flags: 0x0},
+ 496: {region: 0x165, script: 0x57, flags: 0x0},
+ 497: {region: 0xe7, script: 0x57, flags: 0x0},
+ 498: {region: 0x165, script: 0x57, flags: 0x0},
+ 499: {region: 0x95, script: 0x57, flags: 0x0},
+ 500: {region: 0x106, script: 0x1f, flags: 0x0},
+ 501: {region: 0x1, script: 0x57, flags: 0x0},
+ 502: {region: 0x165, script: 0x57, flags: 0x0},
+ 503: {region: 0x165, script: 0x57, flags: 0x0},
+ 504: {region: 0x9d, script: 0x57, flags: 0x0},
+ 505: {region: 0x9e, script: 0x57, flags: 0x0},
+ 506: {region: 0x49, script: 0x17, flags: 0x0},
+ 507: {region: 0x97, script: 0x3b, flags: 0x0},
+ 508: {region: 0x165, script: 0x57, flags: 0x0},
+ 509: {region: 0x165, script: 0x57, flags: 0x0},
+ 510: {region: 0x106, script: 0x57, flags: 0x0},
+ 511: {region: 0x165, script: 0x57, flags: 0x0},
+ 512: {region: 0xa2, script: 0x46, flags: 0x0},
+ 513: {region: 0x165, script: 0x57, flags: 0x0},
+ 514: {region: 0xa0, script: 0x57, flags: 0x0},
+ 515: {region: 0x1, script: 0x57, flags: 0x0},
+ 516: {region: 0x165, script: 0x57, flags: 0x0},
+ 517: {region: 0x165, script: 0x57, flags: 0x0},
+ 518: {region: 0x165, script: 0x57, flags: 0x0},
+ 519: {region: 0x52, script: 0x57, flags: 0x0},
+ 520: {region: 0x130, script: 0x3b, flags: 0x0},
+ 521: {region: 0x165, script: 0x57, flags: 0x0},
+ 522: {region: 0x12f, script: 0x57, flags: 0x0},
+ 523: {region: 0xdb, script: 0x21, flags: 0x0},
+ 524: {region: 0x165, script: 0x57, flags: 0x0},
+ 525: {region: 0x63, script: 0x57, flags: 0x0},
+ 526: {region: 0x95, script: 0x57, flags: 0x0},
+ 527: {region: 0x95, script: 0x57, flags: 0x0},
+ 528: {region: 0x7d, script: 0x2b, flags: 0x0},
+ 529: {region: 0x137, script: 0x1f, flags: 0x0},
+ 530: {region: 0x67, script: 0x57, flags: 0x0},
+ 531: {region: 0xc4, script: 0x57, flags: 0x0},
+ 532: {region: 0x165, script: 0x57, flags: 0x0},
+ 533: {region: 0x165, script: 0x57, flags: 0x0},
+ 534: {region: 0xd6, script: 0x57, flags: 0x0},
+ 535: {region: 0xa4, script: 0x57, flags: 0x0},
+ 536: {region: 0xc3, script: 0x57, flags: 0x0},
+ 537: {region: 0x106, script: 0x1f, flags: 0x0},
+ 538: {region: 0x165, script: 0x57, flags: 0x0},
+ 539: {region: 0x165, script: 0x57, flags: 0x0},
+ 540: {region: 0x165, script: 0x57, flags: 0x0},
+ 541: {region: 0x165, script: 0x57, flags: 0x0},
+ 542: {region: 0xd4, script: 0x5, flags: 0x0},
+ 543: {region: 0xd6, script: 0x57, flags: 0x0},
+ 544: {region: 0x164, script: 0x57, flags: 0x0},
+ 545: {region: 0x165, script: 0x57, flags: 0x0},
+ 546: {region: 0x165, script: 0x57, flags: 0x0},
+ 547: {region: 0x12f, script: 0x57, flags: 0x0},
+ 548: {region: 0x122, script: 0x5, flags: 0x0},
+ 549: {region: 0x165, script: 0x57, flags: 0x0},
+ 550: {region: 0x123, script: 0xdf, flags: 0x0},
+ 551: {region: 0x5a, script: 0x57, flags: 0x0},
+ 552: {region: 0x52, script: 0x57, flags: 0x0},
+ 553: {region: 0x165, script: 0x57, flags: 0x0},
+ 554: {region: 0x4f, script: 0x57, flags: 0x0},
+ 555: {region: 0x99, script: 0x21, flags: 0x0},
+ 556: {region: 0x99, script: 0x21, flags: 0x0},
+ 557: {region: 0x4b, script: 0x57, flags: 0x0},
+ 558: {region: 0x95, script: 0x57, flags: 0x0},
+ 559: {region: 0x165, script: 0x57, flags: 0x0},
+ 560: {region: 0x41, script: 0x57, flags: 0x0},
+ 561: {region: 0x99, script: 0x57, flags: 0x0},
+ 562: {region: 0x53, script: 0xd6, flags: 0x0},
+ 563: {region: 0x99, script: 0x21, flags: 0x0},
+ 564: {region: 0xc3, script: 0x57, flags: 0x0},
+ 565: {region: 0x165, script: 0x57, flags: 0x0},
+ 566: {region: 0x99, script: 0x72, flags: 0x0},
+ 567: {region: 0xe8, script: 0x5, flags: 0x0},
+ 568: {region: 0x165, script: 0x57, flags: 0x0},
+ 569: {region: 0xa4, script: 0x57, flags: 0x0},
+ 570: {region: 0x165, script: 0x57, flags: 0x0},
+ 571: {region: 0x12b, script: 0x57, flags: 0x0},
+ 572: {region: 0x165, script: 0x57, flags: 0x0},
+ 573: {region: 0xd2, script: 0x57, flags: 0x0},
+ 574: {region: 0x165, script: 0x57, flags: 0x0},
+ 575: {region: 0xaf, script: 0x54, flags: 0x0},
+ 576: {region: 0x165, script: 0x57, flags: 0x0},
+ 577: {region: 0x165, script: 0x57, flags: 0x0},
+ 578: {region: 0x13, script: 0x6, flags: 0x1},
+ 579: {region: 0x165, script: 0x57, flags: 0x0},
+ 580: {region: 0x52, script: 0x57, flags: 0x0},
+ 581: {region: 0x82, script: 0x57, flags: 0x0},
+ 582: {region: 0xa4, script: 0x57, flags: 0x0},
+ 583: {region: 0x165, script: 0x57, flags: 0x0},
+ 584: {region: 0x165, script: 0x57, flags: 0x0},
+ 585: {region: 0x165, script: 0x57, flags: 0x0},
+ 586: {region: 0xa6, script: 0x4b, flags: 0x0},
+ 587: {region: 0x2a, script: 0x57, flags: 0x0},
+ 588: {region: 0x165, script: 0x57, flags: 0x0},
+ 589: {region: 0x165, script: 0x57, flags: 0x0},
+ 590: {region: 0x165, script: 0x57, flags: 0x0},
+ 591: {region: 0x165, script: 0x57, flags: 0x0},
+ 592: {region: 0x165, script: 0x57, flags: 0x0},
+ 593: {region: 0x99, script: 0x4f, flags: 0x0},
+ 594: {region: 0x8b, script: 0x57, flags: 0x0},
+ 595: {region: 0x165, script: 0x57, flags: 0x0},
+ 596: {region: 0xab, script: 0x50, flags: 0x0},
+ 597: {region: 0x106, script: 0x1f, flags: 0x0},
+ 598: {region: 0x99, script: 0x21, flags: 0x0},
+ 599: {region: 0x165, script: 0x57, flags: 0x0},
+ 600: {region: 0x75, script: 0x57, flags: 0x0},
+ 601: {region: 0x165, script: 0x57, flags: 0x0},
+ 602: {region: 0xb4, script: 0x57, flags: 0x0},
+ 603: {region: 0x165, script: 0x57, flags: 0x0},
+ 604: {region: 0x165, script: 0x57, flags: 0x0},
+ 605: {region: 0x165, script: 0x57, flags: 0x0},
+ 606: {region: 0x165, script: 0x57, flags: 0x0},
+ 607: {region: 0x165, script: 0x57, flags: 0x0},
+ 608: {region: 0x165, script: 0x57, flags: 0x0},
+ 609: {region: 0x165, script: 0x57, flags: 0x0},
+ 610: {region: 0x165, script: 0x29, flags: 0x0},
+ 611: {region: 0x165, script: 0x57, flags: 0x0},
+ 612: {region: 0x106, script: 0x1f, flags: 0x0},
+ 613: {region: 0x112, script: 0x57, flags: 0x0},
+ 614: {region: 0xe7, script: 0x57, flags: 0x0},
+ 615: {region: 0x106, script: 0x57, flags: 0x0},
+ 616: {region: 0x165, script: 0x57, flags: 0x0},
+ 617: {region: 0x99, script: 0x21, flags: 0x0},
+ 618: {region: 0x99, script: 0x5, flags: 0x0},
+ 619: {region: 0x12f, script: 0x57, flags: 0x0},
+ 620: {region: 0x165, script: 0x57, flags: 0x0},
+ 621: {region: 0x52, script: 0x57, flags: 0x0},
+ 622: {region: 0x60, script: 0x57, flags: 0x0},
+ 623: {region: 0x165, script: 0x57, flags: 0x0},
+ 624: {region: 0x165, script: 0x57, flags: 0x0},
+ 625: {region: 0x165, script: 0x29, flags: 0x0},
+ 626: {region: 0x165, script: 0x57, flags: 0x0},
+ 627: {region: 0x165, script: 0x57, flags: 0x0},
+ 628: {region: 0x19, script: 0x3, flags: 0x1},
+ 629: {region: 0x165, script: 0x57, flags: 0x0},
+ 630: {region: 0x165, script: 0x57, flags: 0x0},
+ 631: {region: 0x165, script: 0x57, flags: 0x0},
+ 632: {region: 0x165, script: 0x57, flags: 0x0},
+ 633: {region: 0x106, script: 0x1f, flags: 0x0},
+ 634: {region: 0x165, script: 0x57, flags: 0x0},
+ 635: {region: 0x165, script: 0x57, flags: 0x0},
+ 636: {region: 0x165, script: 0x57, flags: 0x0},
+ 637: {region: 0x106, script: 0x1f, flags: 0x0},
+ 638: {region: 0x165, script: 0x57, flags: 0x0},
+ 639: {region: 0x95, script: 0x57, flags: 0x0},
+ 640: {region: 0xe8, script: 0x5, flags: 0x0},
+ 641: {region: 0x7b, script: 0x57, flags: 0x0},
+ 642: {region: 0x165, script: 0x57, flags: 0x0},
+ 643: {region: 0x165, script: 0x57, flags: 0x0},
+ 644: {region: 0x165, script: 0x57, flags: 0x0},
+ 645: {region: 0x165, script: 0x29, flags: 0x0},
+ 646: {region: 0x123, script: 0xdf, flags: 0x0},
+ 647: {region: 0xe8, script: 0x5, flags: 0x0},
+ 648: {region: 0x165, script: 0x57, flags: 0x0},
+ 649: {region: 0x165, script: 0x57, flags: 0x0},
+ 650: {region: 0x1c, script: 0x5, flags: 0x1},
+ 651: {region: 0x165, script: 0x57, flags: 0x0},
+ 652: {region: 0x165, script: 0x57, flags: 0x0},
+ 653: {region: 0x165, script: 0x57, flags: 0x0},
+ 654: {region: 0x138, script: 0x57, flags: 0x0},
+ 655: {region: 0x87, script: 0x5b, flags: 0x0},
+ 656: {region: 0x97, script: 0x3b, flags: 0x0},
+ 657: {region: 0x12f, script: 0x57, flags: 0x0},
+ 658: {region: 0xe8, script: 0x5, flags: 0x0},
+ 659: {region: 0x131, script: 0x57, flags: 0x0},
+ 660: {region: 0x165, script: 0x57, flags: 0x0},
+ 661: {region: 0xb7, script: 0x57, flags: 0x0},
+ 662: {region: 0x106, script: 0x1f, flags: 0x0},
+ 663: {region: 0x165, script: 0x57, flags: 0x0},
+ 664: {region: 0x95, script: 0x57, flags: 0x0},
+ 665: {region: 0x165, script: 0x57, flags: 0x0},
+ 666: {region: 0x53, script: 0xdf, flags: 0x0},
+ 667: {region: 0x165, script: 0x57, flags: 0x0},
+ 668: {region: 0x165, script: 0x57, flags: 0x0},
+ 669: {region: 0x165, script: 0x57, flags: 0x0},
+ 670: {region: 0x165, script: 0x57, flags: 0x0},
+ 671: {region: 0x99, script: 0x59, flags: 0x0},
+ 672: {region: 0x165, script: 0x57, flags: 0x0},
+ 673: {region: 0x165, script: 0x57, flags: 0x0},
+ 674: {region: 0x106, script: 0x1f, flags: 0x0},
+ 675: {region: 0x131, script: 0x57, flags: 0x0},
+ 676: {region: 0x165, script: 0x57, flags: 0x0},
+ 677: {region: 0xd9, script: 0x57, flags: 0x0},
+ 678: {region: 0x165, script: 0x57, flags: 0x0},
+ 679: {region: 0x165, script: 0x57, flags: 0x0},
+ 680: {region: 0x21, script: 0x2, flags: 0x1},
+ 681: {region: 0x165, script: 0x57, flags: 0x0},
+ 682: {region: 0x165, script: 0x57, flags: 0x0},
+ 683: {region: 0x9e, script: 0x57, flags: 0x0},
+ 684: {region: 0x53, script: 0x5d, flags: 0x0},
+ 685: {region: 0x95, script: 0x57, flags: 0x0},
+ 686: {region: 0x9c, script: 0x5, flags: 0x0},
+ 687: {region: 0x135, script: 0x57, flags: 0x0},
+ 688: {region: 0x165, script: 0x57, flags: 0x0},
+ 689: {region: 0x165, script: 0x57, flags: 0x0},
+ 690: {region: 0x99, script: 0xda, flags: 0x0},
+ 691: {region: 0x9e, script: 0x57, flags: 0x0},
+ 692: {region: 0x165, script: 0x57, flags: 0x0},
+ 693: {region: 0x4b, script: 0x57, flags: 0x0},
+ 694: {region: 0x165, script: 0x57, flags: 0x0},
+ 695: {region: 0x165, script: 0x57, flags: 0x0},
+ 696: {region: 0xaf, script: 0x54, flags: 0x0},
+ 697: {region: 0x165, script: 0x57, flags: 0x0},
+ 698: {region: 0x165, script: 0x57, flags: 0x0},
+ 699: {region: 0x4b, script: 0x57, flags: 0x0},
+ 700: {region: 0x165, script: 0x57, flags: 0x0},
+ 701: {region: 0x165, script: 0x57, flags: 0x0},
+ 702: {region: 0x162, script: 0x57, flags: 0x0},
+ 703: {region: 0x9c, script: 0x5, flags: 0x0},
+ 704: {region: 0xb6, script: 0x57, flags: 0x0},
+ 705: {region: 0xb8, script: 0x57, flags: 0x0},
+ 706: {region: 0x4b, script: 0x57, flags: 0x0},
+ 707: {region: 0x4b, script: 0x57, flags: 0x0},
+ 708: {region: 0xa4, script: 0x57, flags: 0x0},
+ 709: {region: 0xa4, script: 0x57, flags: 0x0},
+ 710: {region: 0x9c, script: 0x5, flags: 0x0},
+ 711: {region: 0xb8, script: 0x57, flags: 0x0},
+ 712: {region: 0x123, script: 0xdf, flags: 0x0},
+ 713: {region: 0x53, script: 0x38, flags: 0x0},
+ 714: {region: 0x12b, script: 0x57, flags: 0x0},
+ 715: {region: 0x95, script: 0x57, flags: 0x0},
+ 716: {region: 0x52, script: 0x57, flags: 0x0},
+ 717: {region: 0x99, script: 0x21, flags: 0x0},
+ 718: {region: 0x99, script: 0x21, flags: 0x0},
+ 719: {region: 0x95, script: 0x57, flags: 0x0},
+ 720: {region: 0x23, script: 0x3, flags: 0x1},
+ 721: {region: 0xa4, script: 0x57, flags: 0x0},
+ 722: {region: 0x165, script: 0x57, flags: 0x0},
+ 723: {region: 0xcf, script: 0x57, flags: 0x0},
+ 724: {region: 0x165, script: 0x57, flags: 0x0},
+ 725: {region: 0x165, script: 0x57, flags: 0x0},
+ 726: {region: 0x165, script: 0x57, flags: 0x0},
+ 727: {region: 0x165, script: 0x57, flags: 0x0},
+ 728: {region: 0x165, script: 0x57, flags: 0x0},
+ 729: {region: 0x165, script: 0x57, flags: 0x0},
+ 730: {region: 0x165, script: 0x57, flags: 0x0},
+ 731: {region: 0x165, script: 0x57, flags: 0x0},
+ 732: {region: 0x165, script: 0x57, flags: 0x0},
+ 733: {region: 0x165, script: 0x57, flags: 0x0},
+ 734: {region: 0x165, script: 0x57, flags: 0x0},
+ 735: {region: 0x165, script: 0x5, flags: 0x0},
+ 736: {region: 0x106, script: 0x1f, flags: 0x0},
+ 737: {region: 0xe7, script: 0x57, flags: 0x0},
+ 738: {region: 0x165, script: 0x57, flags: 0x0},
+ 739: {region: 0x95, script: 0x57, flags: 0x0},
+ 740: {region: 0x165, script: 0x29, flags: 0x0},
+ 741: {region: 0x165, script: 0x57, flags: 0x0},
+ 742: {region: 0x165, script: 0x57, flags: 0x0},
+ 743: {region: 0x165, script: 0x57, flags: 0x0},
+ 744: {region: 0x112, script: 0x57, flags: 0x0},
+ 745: {region: 0xa4, script: 0x57, flags: 0x0},
+ 746: {region: 0x165, script: 0x57, flags: 0x0},
+ 747: {region: 0x165, script: 0x57, flags: 0x0},
+ 748: {region: 0x123, script: 0x5, flags: 0x0},
+ 749: {region: 0xcc, script: 0x57, flags: 0x0},
+ 750: {region: 0x165, script: 0x57, flags: 0x0},
+ 751: {region: 0x165, script: 0x57, flags: 0x0},
+ 752: {region: 0x165, script: 0x57, flags: 0x0},
+ 753: {region: 0xbf, script: 0x57, flags: 0x0},
+ 754: {region: 0xd1, script: 0x57, flags: 0x0},
+ 755: {region: 0x165, script: 0x57, flags: 0x0},
+ 756: {region: 0x52, script: 0x57, flags: 0x0},
+ 757: {region: 0xdb, script: 0x21, flags: 0x0},
+ 758: {region: 0x12f, script: 0x57, flags: 0x0},
+ 759: {region: 0xc0, script: 0x57, flags: 0x0},
+ 760: {region: 0x165, script: 0x57, flags: 0x0},
+ 761: {region: 0x165, script: 0x57, flags: 0x0},
+ 762: {region: 0xe0, script: 0x57, flags: 0x0},
+ 763: {region: 0x165, script: 0x57, flags: 0x0},
+ 764: {region: 0x95, script: 0x57, flags: 0x0},
+ 765: {region: 0x9b, script: 0x3a, flags: 0x0},
+ 766: {region: 0x165, script: 0x57, flags: 0x0},
+ 767: {region: 0xc2, script: 0x1f, flags: 0x0},
+ 768: {region: 0x165, script: 0x5, flags: 0x0},
+ 769: {region: 0x165, script: 0x57, flags: 0x0},
+ 770: {region: 0x165, script: 0x57, flags: 0x0},
+ 771: {region: 0x165, script: 0x57, flags: 0x0},
+ 772: {region: 0x99, script: 0x6b, flags: 0x0},
+ 773: {region: 0x165, script: 0x57, flags: 0x0},
+ 774: {region: 0x165, script: 0x57, flags: 0x0},
+ 775: {region: 0x10b, script: 0x57, flags: 0x0},
+ 776: {region: 0x165, script: 0x57, flags: 0x0},
+ 777: {region: 0x165, script: 0x57, flags: 0x0},
+ 778: {region: 0x165, script: 0x57, flags: 0x0},
+ 779: {region: 0x26, script: 0x3, flags: 0x1},
+ 780: {region: 0x165, script: 0x57, flags: 0x0},
+ 781: {region: 0x165, script: 0x57, flags: 0x0},
+ 782: {region: 0x99, script: 0xe, flags: 0x0},
+ 783: {region: 0xc4, script: 0x72, flags: 0x0},
+ 785: {region: 0x165, script: 0x57, flags: 0x0},
+ 786: {region: 0x49, script: 0x57, flags: 0x0},
+ 787: {region: 0x49, script: 0x57, flags: 0x0},
+ 788: {region: 0x37, script: 0x57, flags: 0x0},
+ 789: {region: 0x165, script: 0x57, flags: 0x0},
+ 790: {region: 0x165, script: 0x57, flags: 0x0},
+ 791: {region: 0x165, script: 0x57, flags: 0x0},
+ 792: {region: 0x165, script: 0x57, flags: 0x0},
+ 793: {region: 0x165, script: 0x57, flags: 0x0},
+ 794: {region: 0x165, script: 0x57, flags: 0x0},
+ 795: {region: 0x99, script: 0x21, flags: 0x0},
+ 796: {region: 0xdb, script: 0x21, flags: 0x0},
+ 797: {region: 0x106, script: 0x1f, flags: 0x0},
+ 798: {region: 0x35, script: 0x6f, flags: 0x0},
+ 799: {region: 0x29, script: 0x3, flags: 0x1},
+ 800: {region: 0xcb, script: 0x57, flags: 0x0},
+ 801: {region: 0x165, script: 0x57, flags: 0x0},
+ 802: {region: 0x165, script: 0x57, flags: 0x0},
+ 803: {region: 0x165, script: 0x57, flags: 0x0},
+ 804: {region: 0x99, script: 0x21, flags: 0x0},
+ 805: {region: 0x52, script: 0x57, flags: 0x0},
+ 807: {region: 0x165, script: 0x57, flags: 0x0},
+ 808: {region: 0x135, script: 0x57, flags: 0x0},
+ 809: {region: 0x165, script: 0x57, flags: 0x0},
+ 810: {region: 0x165, script: 0x57, flags: 0x0},
+ 811: {region: 0xe8, script: 0x5, flags: 0x0},
+ 812: {region: 0xc3, script: 0x57, flags: 0x0},
+ 813: {region: 0x99, script: 0x21, flags: 0x0},
+ 814: {region: 0x95, script: 0x57, flags: 0x0},
+ 815: {region: 0x164, script: 0x57, flags: 0x0},
+ 816: {region: 0x165, script: 0x57, flags: 0x0},
+ 817: {region: 0xc4, script: 0x72, flags: 0x0},
+ 818: {region: 0x165, script: 0x57, flags: 0x0},
+ 819: {region: 0x165, script: 0x29, flags: 0x0},
+ 820: {region: 0x106, script: 0x1f, flags: 0x0},
+ 821: {region: 0x165, script: 0x57, flags: 0x0},
+ 822: {region: 0x131, script: 0x57, flags: 0x0},
+ 823: {region: 0x9c, script: 0x63, flags: 0x0},
+ 824: {region: 0x165, script: 0x57, flags: 0x0},
+ 825: {region: 0x165, script: 0x57, flags: 0x0},
+ 826: {region: 0x9c, script: 0x5, flags: 0x0},
+ 827: {region: 0x165, script: 0x57, flags: 0x0},
+ 828: {region: 0x165, script: 0x57, flags: 0x0},
+ 829: {region: 0x165, script: 0x57, flags: 0x0},
+ 830: {region: 0xdd, script: 0x57, flags: 0x0},
+ 831: {region: 0x165, script: 0x57, flags: 0x0},
+ 832: {region: 0x165, script: 0x57, flags: 0x0},
+ 834: {region: 0x165, script: 0x57, flags: 0x0},
+ 835: {region: 0x53, script: 0x38, flags: 0x0},
+ 836: {region: 0x9e, script: 0x57, flags: 0x0},
+ 837: {region: 0xd2, script: 0x57, flags: 0x0},
+ 838: {region: 0x165, script: 0x57, flags: 0x0},
+ 839: {region: 0xda, script: 0x57, flags: 0x0},
+ 840: {region: 0x165, script: 0x57, flags: 0x0},
+ 841: {region: 0x165, script: 0x57, flags: 0x0},
+ 842: {region: 0x165, script: 0x57, flags: 0x0},
+ 843: {region: 0xcf, script: 0x57, flags: 0x0},
+ 844: {region: 0x165, script: 0x57, flags: 0x0},
+ 845: {region: 0x165, script: 0x57, flags: 0x0},
+ 846: {region: 0x164, script: 0x57, flags: 0x0},
+ 847: {region: 0xd1, script: 0x57, flags: 0x0},
+ 848: {region: 0x60, script: 0x57, flags: 0x0},
+ 849: {region: 0xdb, script: 0x21, flags: 0x0},
+ 850: {region: 0x165, script: 0x57, flags: 0x0},
+ 851: {region: 0xdb, script: 0x21, flags: 0x0},
+ 852: {region: 0x165, script: 0x57, flags: 0x0},
+ 853: {region: 0x165, script: 0x57, flags: 0x0},
+ 854: {region: 0xd2, script: 0x57, flags: 0x0},
+ 855: {region: 0x165, script: 0x57, flags: 0x0},
+ 856: {region: 0x165, script: 0x57, flags: 0x0},
+ 857: {region: 0xd1, script: 0x57, flags: 0x0},
+ 858: {region: 0x165, script: 0x57, flags: 0x0},
+ 859: {region: 0xcf, script: 0x57, flags: 0x0},
+ 860: {region: 0xcf, script: 0x57, flags: 0x0},
+ 861: {region: 0x165, script: 0x57, flags: 0x0},
+ 862: {region: 0x165, script: 0x57, flags: 0x0},
+ 863: {region: 0x95, script: 0x57, flags: 0x0},
+ 864: {region: 0x165, script: 0x57, flags: 0x0},
+ 865: {region: 0xdf, script: 0x57, flags: 0x0},
+ 866: {region: 0x165, script: 0x57, flags: 0x0},
+ 867: {region: 0x165, script: 0x57, flags: 0x0},
+ 868: {region: 0x99, script: 0x57, flags: 0x0},
+ 869: {region: 0x165, script: 0x57, flags: 0x0},
+ 870: {region: 0x165, script: 0x57, flags: 0x0},
+ 871: {region: 0xd9, script: 0x57, flags: 0x0},
+ 872: {region: 0x52, script: 0x57, flags: 0x0},
+ 873: {region: 0x165, script: 0x57, flags: 0x0},
+ 874: {region: 0xda, script: 0x57, flags: 0x0},
+ 875: {region: 0x165, script: 0x57, flags: 0x0},
+ 876: {region: 0x52, script: 0x57, flags: 0x0},
+ 877: {region: 0x165, script: 0x57, flags: 0x0},
+ 878: {region: 0x165, script: 0x57, flags: 0x0},
+ 879: {region: 0xda, script: 0x57, flags: 0x0},
+ 880: {region: 0x123, script: 0x53, flags: 0x0},
+ 881: {region: 0x99, script: 0x21, flags: 0x0},
+ 882: {region: 0x10c, script: 0xbf, flags: 0x0},
+ 883: {region: 0x165, script: 0x57, flags: 0x0},
+ 884: {region: 0x165, script: 0x57, flags: 0x0},
+ 885: {region: 0x84, script: 0x78, flags: 0x0},
+ 886: {region: 0x161, script: 0x57, flags: 0x0},
+ 887: {region: 0x165, script: 0x57, flags: 0x0},
+ 888: {region: 0x49, script: 0x17, flags: 0x0},
+ 889: {region: 0x165, script: 0x57, flags: 0x0},
+ 890: {region: 0x161, script: 0x57, flags: 0x0},
+ 891: {region: 0x165, script: 0x57, flags: 0x0},
+ 892: {region: 0x165, script: 0x57, flags: 0x0},
+ 893: {region: 0x165, script: 0x57, flags: 0x0},
+ 894: {region: 0x165, script: 0x57, flags: 0x0},
+ 895: {region: 0x165, script: 0x57, flags: 0x0},
+ 896: {region: 0x117, script: 0x57, flags: 0x0},
+ 897: {region: 0x165, script: 0x57, flags: 0x0},
+ 898: {region: 0x165, script: 0x57, flags: 0x0},
+ 899: {region: 0x135, script: 0x57, flags: 0x0},
+ 900: {region: 0x165, script: 0x57, flags: 0x0},
+ 901: {region: 0x53, script: 0x57, flags: 0x0},
+ 902: {region: 0x165, script: 0x57, flags: 0x0},
+ 903: {region: 0xce, script: 0x57, flags: 0x0},
+ 904: {region: 0x12f, script: 0x57, flags: 0x0},
+ 905: {region: 0x131, script: 0x57, flags: 0x0},
+ 906: {region: 0x80, script: 0x57, flags: 0x0},
+ 907: {region: 0x78, script: 0x57, flags: 0x0},
+ 908: {region: 0x165, script: 0x57, flags: 0x0},
+ 910: {region: 0x165, script: 0x57, flags: 0x0},
+ 911: {region: 0x165, script: 0x57, flags: 0x0},
+ 912: {region: 0x6f, script: 0x57, flags: 0x0},
+ 913: {region: 0x165, script: 0x57, flags: 0x0},
+ 914: {region: 0x165, script: 0x57, flags: 0x0},
+ 915: {region: 0x165, script: 0x57, flags: 0x0},
+ 916: {region: 0x165, script: 0x57, flags: 0x0},
+ 917: {region: 0x99, script: 0x7d, flags: 0x0},
+ 918: {region: 0x165, script: 0x57, flags: 0x0},
+ 919: {region: 0x165, script: 0x5, flags: 0x0},
+ 920: {region: 0x7d, script: 0x1f, flags: 0x0},
+ 921: {region: 0x135, script: 0x7e, flags: 0x0},
+ 922: {region: 0x165, script: 0x5, flags: 0x0},
+ 923: {region: 0xc5, script: 0x7c, flags: 0x0},
+ 924: {region: 0x165, script: 0x57, flags: 0x0},
+ 925: {region: 0x2c, script: 0x3, flags: 0x1},
+ 926: {region: 0xe7, script: 0x57, flags: 0x0},
+ 927: {region: 0x2f, script: 0x2, flags: 0x1},
+ 928: {region: 0xe7, script: 0x57, flags: 0x0},
+ 929: {region: 0x30, script: 0x57, flags: 0x0},
+ 930: {region: 0xf0, script: 0x57, flags: 0x0},
+ 931: {region: 0x165, script: 0x57, flags: 0x0},
+ 932: {region: 0x78, script: 0x57, flags: 0x0},
+ 933: {region: 0xd6, script: 0x57, flags: 0x0},
+ 934: {region: 0x135, script: 0x57, flags: 0x0},
+ 935: {region: 0x49, script: 0x57, flags: 0x0},
+ 936: {region: 0x165, script: 0x57, flags: 0x0},
+ 937: {region: 0x9c, script: 0xe8, flags: 0x0},
+ 938: {region: 0x165, script: 0x57, flags: 0x0},
+ 939: {region: 0x60, script: 0x57, flags: 0x0},
+ 940: {region: 0x165, script: 0x5, flags: 0x0},
+ 941: {region: 0xb0, script: 0x87, flags: 0x0},
+ 943: {region: 0x165, script: 0x57, flags: 0x0},
+ 944: {region: 0x165, script: 0x57, flags: 0x0},
+ 945: {region: 0x99, script: 0x12, flags: 0x0},
+ 946: {region: 0xa4, script: 0x57, flags: 0x0},
+ 947: {region: 0xe9, script: 0x57, flags: 0x0},
+ 948: {region: 0x165, script: 0x57, flags: 0x0},
+ 949: {region: 0x9e, script: 0x57, flags: 0x0},
+ 950: {region: 0x165, script: 0x57, flags: 0x0},
+ 951: {region: 0x165, script: 0x57, flags: 0x0},
+ 952: {region: 0x87, script: 0x31, flags: 0x0},
+ 953: {region: 0x75, script: 0x57, flags: 0x0},
+ 954: {region: 0x165, script: 0x57, flags: 0x0},
+ 955: {region: 0xe8, script: 0x4a, flags: 0x0},
+ 956: {region: 0x9c, script: 0x5, flags: 0x0},
+ 957: {region: 0x1, script: 0x57, flags: 0x0},
+ 958: {region: 0x24, script: 0x5, flags: 0x0},
+ 959: {region: 0x165, script: 0x57, flags: 0x0},
+ 960: {region: 0x41, script: 0x57, flags: 0x0},
+ 961: {region: 0x165, script: 0x57, flags: 0x0},
+ 962: {region: 0x7a, script: 0x57, flags: 0x0},
+ 963: {region: 0x165, script: 0x57, flags: 0x0},
+ 964: {region: 0xe4, script: 0x57, flags: 0x0},
+ 965: {region: 0x89, script: 0x57, flags: 0x0},
+ 966: {region: 0x69, script: 0x57, flags: 0x0},
+ 967: {region: 0x165, script: 0x57, flags: 0x0},
+ 968: {region: 0x99, script: 0x21, flags: 0x0},
+ 969: {region: 0x165, script: 0x57, flags: 0x0},
+ 970: {region: 0x102, script: 0x57, flags: 0x0},
+ 971: {region: 0x95, script: 0x57, flags: 0x0},
+ 972: {region: 0x165, script: 0x57, flags: 0x0},
+ 973: {region: 0x165, script: 0x57, flags: 0x0},
+ 974: {region: 0x9e, script: 0x57, flags: 0x0},
+ 975: {region: 0x165, script: 0x5, flags: 0x0},
+ 976: {region: 0x99, script: 0x57, flags: 0x0},
+ 977: {region: 0x31, script: 0x2, flags: 0x1},
+ 978: {region: 0xdb, script: 0x21, flags: 0x0},
+ 979: {region: 0x35, script: 0xe, flags: 0x0},
+ 980: {region: 0x4e, script: 0x57, flags: 0x0},
+ 981: {region: 0x72, script: 0x57, flags: 0x0},
+ 982: {region: 0x4e, script: 0x57, flags: 0x0},
+ 983: {region: 0x9c, script: 0x5, flags: 0x0},
+ 984: {region: 0x10c, script: 0x57, flags: 0x0},
+ 985: {region: 0x3a, script: 0x57, flags: 0x0},
+ 986: {region: 0x165, script: 0x57, flags: 0x0},
+ 987: {region: 0xd1, script: 0x57, flags: 0x0},
+ 988: {region: 0x104, script: 0x57, flags: 0x0},
+ 989: {region: 0x95, script: 0x57, flags: 0x0},
+ 990: {region: 0x12f, script: 0x57, flags: 0x0},
+ 991: {region: 0x165, script: 0x57, flags: 0x0},
+ 992: {region: 0x165, script: 0x57, flags: 0x0},
+ 993: {region: 0x73, script: 0x57, flags: 0x0},
+ 994: {region: 0x106, script: 0x1f, flags: 0x0},
+ 995: {region: 0x130, script: 0x1f, flags: 0x0},
+ 996: {region: 0x109, script: 0x57, flags: 0x0},
+ 997: {region: 0x107, script: 0x57, flags: 0x0},
+ 998: {region: 0x12f, script: 0x57, flags: 0x0},
+ 999: {region: 0x165, script: 0x57, flags: 0x0},
+ 1000: {region: 0xa2, script: 0x49, flags: 0x0},
+ 1001: {region: 0x99, script: 0x21, flags: 0x0},
+ 1002: {region: 0x80, script: 0x57, flags: 0x0},
+ 1003: {region: 0x106, script: 0x1f, flags: 0x0},
+ 1004: {region: 0xa4, script: 0x57, flags: 0x0},
+ 1005: {region: 0x95, script: 0x57, flags: 0x0},
+ 1006: {region: 0x99, script: 0x57, flags: 0x0},
+ 1007: {region: 0x114, script: 0x57, flags: 0x0},
+ 1008: {region: 0x99, script: 0xc3, flags: 0x0},
+ 1009: {region: 0x165, script: 0x57, flags: 0x0},
+ 1010: {region: 0x165, script: 0x57, flags: 0x0},
+ 1011: {region: 0x12f, script: 0x57, flags: 0x0},
+ 1012: {region: 0x9e, script: 0x57, flags: 0x0},
+ 1013: {region: 0x99, script: 0x21, flags: 0x0},
+ 1014: {region: 0x165, script: 0x5, flags: 0x0},
+ 1015: {region: 0x9e, script: 0x57, flags: 0x0},
+ 1016: {region: 0x7b, script: 0x57, flags: 0x0},
+ 1017: {region: 0x49, script: 0x57, flags: 0x0},
+ 1018: {region: 0x33, script: 0x4, flags: 0x1},
+ 1019: {region: 0x9e, script: 0x57, flags: 0x0},
+ 1020: {region: 0x9c, script: 0x5, flags: 0x0},
+ 1021: {region: 0xda, script: 0x57, flags: 0x0},
+ 1022: {region: 0x4f, script: 0x57, flags: 0x0},
+ 1023: {region: 0xd1, script: 0x57, flags: 0x0},
+ 1024: {region: 0xcf, script: 0x57, flags: 0x0},
+ 1025: {region: 0xc3, script: 0x57, flags: 0x0},
+ 1026: {region: 0x4c, script: 0x57, flags: 0x0},
+ 1027: {region: 0x96, script: 0x7a, flags: 0x0},
+ 1028: {region: 0xb6, script: 0x57, flags: 0x0},
+ 1029: {region: 0x165, script: 0x29, flags: 0x0},
+ 1030: {region: 0x165, script: 0x57, flags: 0x0},
+ 1032: {region: 0xba, script: 0xdc, flags: 0x0},
+ 1033: {region: 0x165, script: 0x57, flags: 0x0},
+ 1034: {region: 0xc4, script: 0x72, flags: 0x0},
+ 1035: {region: 0x165, script: 0x5, flags: 0x0},
+ 1036: {region: 0xb3, script: 0xca, flags: 0x0},
+ 1037: {region: 0x6f, script: 0x57, flags: 0x0},
+ 1038: {region: 0x165, script: 0x57, flags: 0x0},
+ 1039: {region: 0x165, script: 0x57, flags: 0x0},
+ 1040: {region: 0x165, script: 0x57, flags: 0x0},
+ 1041: {region: 0x165, script: 0x57, flags: 0x0},
+ 1042: {region: 0x111, script: 0x57, flags: 0x0},
+ 1043: {region: 0x165, script: 0x57, flags: 0x0},
+ 1044: {region: 0xe8, script: 0x5, flags: 0x0},
+ 1045: {region: 0x165, script: 0x57, flags: 0x0},
+ 1046: {region: 0x10f, script: 0x57, flags: 0x0},
+ 1047: {region: 0x165, script: 0x57, flags: 0x0},
+ 1048: {region: 0xe9, script: 0x57, flags: 0x0},
+ 1049: {region: 0x165, script: 0x57, flags: 0x0},
+ 1050: {region: 0x95, script: 0x57, flags: 0x0},
+ 1051: {region: 0x142, script: 0x57, flags: 0x0},
+ 1052: {region: 0x10c, script: 0x57, flags: 0x0},
+ 1054: {region: 0x10c, script: 0x57, flags: 0x0},
+ 1055: {region: 0x72, script: 0x57, flags: 0x0},
+ 1056: {region: 0x97, script: 0xc0, flags: 0x0},
+ 1057: {region: 0x165, script: 0x57, flags: 0x0},
+ 1058: {region: 0x72, script: 0x57, flags: 0x0},
+ 1059: {region: 0x164, script: 0x57, flags: 0x0},
+ 1060: {region: 0x165, script: 0x57, flags: 0x0},
+ 1061: {region: 0xc3, script: 0x57, flags: 0x0},
+ 1062: {region: 0x165, script: 0x57, flags: 0x0},
+ 1063: {region: 0x165, script: 0x57, flags: 0x0},
+ 1064: {region: 0x165, script: 0x57, flags: 0x0},
+ 1065: {region: 0x115, script: 0x57, flags: 0x0},
+ 1066: {region: 0x165, script: 0x57, flags: 0x0},
+ 1067: {region: 0x165, script: 0x57, flags: 0x0},
+ 1068: {region: 0x123, script: 0xdf, flags: 0x0},
+ 1069: {region: 0x165, script: 0x57, flags: 0x0},
+ 1070: {region: 0x165, script: 0x57, flags: 0x0},
+ 1071: {region: 0x165, script: 0x57, flags: 0x0},
+ 1072: {region: 0x165, script: 0x57, flags: 0x0},
+ 1073: {region: 0x27, script: 0x57, flags: 0x0},
+ 1074: {region: 0x37, script: 0x5, flags: 0x1},
+ 1075: {region: 0x99, script: 0xcb, flags: 0x0},
+ 1076: {region: 0x116, script: 0x57, flags: 0x0},
+ 1077: {region: 0x114, script: 0x57, flags: 0x0},
+ 1078: {region: 0x99, script: 0x21, flags: 0x0},
+ 1079: {region: 0x161, script: 0x57, flags: 0x0},
+ 1080: {region: 0x165, script: 0x57, flags: 0x0},
+ 1081: {region: 0x165, script: 0x57, flags: 0x0},
+ 1082: {region: 0x6d, script: 0x57, flags: 0x0},
+ 1083: {region: 0x161, script: 0x57, flags: 0x0},
+ 1084: {region: 0x165, script: 0x57, flags: 0x0},
+ 1085: {region: 0x60, script: 0x57, flags: 0x0},
+ 1086: {region: 0x95, script: 0x57, flags: 0x0},
+ 1087: {region: 0x165, script: 0x57, flags: 0x0},
+ 1088: {region: 0x165, script: 0x57, flags: 0x0},
+ 1089: {region: 0x12f, script: 0x57, flags: 0x0},
+ 1090: {region: 0x165, script: 0x57, flags: 0x0},
+ 1091: {region: 0x84, script: 0x57, flags: 0x0},
+ 1092: {region: 0x10c, script: 0x57, flags: 0x0},
+ 1093: {region: 0x12f, script: 0x57, flags: 0x0},
+ 1094: {region: 0x15f, script: 0x5, flags: 0x0},
+ 1095: {region: 0x4b, script: 0x57, flags: 0x0},
+ 1096: {region: 0x60, script: 0x57, flags: 0x0},
+ 1097: {region: 0x165, script: 0x57, flags: 0x0},
+ 1098: {region: 0x99, script: 0x21, flags: 0x0},
+ 1099: {region: 0x95, script: 0x57, flags: 0x0},
+ 1100: {region: 0x165, script: 0x57, flags: 0x0},
+ 1101: {region: 0x35, script: 0xe, flags: 0x0},
+ 1102: {region: 0x9b, script: 0xcf, flags: 0x0},
+ 1103: {region: 0xe9, script: 0x57, flags: 0x0},
+ 1104: {region: 0x99, script: 0xd7, flags: 0x0},
+ 1105: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1106: {region: 0x165, script: 0x57, flags: 0x0},
+ 1107: {region: 0x165, script: 0x57, flags: 0x0},
+ 1108: {region: 0x165, script: 0x57, flags: 0x0},
+ 1109: {region: 0x165, script: 0x57, flags: 0x0},
+ 1110: {region: 0x165, script: 0x57, flags: 0x0},
+ 1111: {region: 0x165, script: 0x57, flags: 0x0},
+ 1112: {region: 0x165, script: 0x57, flags: 0x0},
+ 1113: {region: 0x165, script: 0x57, flags: 0x0},
+ 1114: {region: 0xe7, script: 0x57, flags: 0x0},
+ 1115: {region: 0x165, script: 0x57, flags: 0x0},
+ 1116: {region: 0x165, script: 0x57, flags: 0x0},
+ 1117: {region: 0x99, script: 0x4f, flags: 0x0},
+ 1118: {region: 0x53, script: 0xd5, flags: 0x0},
+ 1119: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1120: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1121: {region: 0x99, script: 0xda, flags: 0x0},
+ 1122: {region: 0x165, script: 0x57, flags: 0x0},
+ 1123: {region: 0x112, script: 0x57, flags: 0x0},
+ 1124: {region: 0x131, script: 0x57, flags: 0x0},
+ 1125: {region: 0x126, script: 0x57, flags: 0x0},
+ 1126: {region: 0x165, script: 0x57, flags: 0x0},
+ 1127: {region: 0x3c, script: 0x3, flags: 0x1},
+ 1128: {region: 0x165, script: 0x57, flags: 0x0},
+ 1129: {region: 0x165, script: 0x57, flags: 0x0},
+ 1130: {region: 0x165, script: 0x57, flags: 0x0},
+ 1131: {region: 0x123, script: 0xdf, flags: 0x0},
+ 1132: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1133: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1134: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1135: {region: 0x6f, script: 0x29, flags: 0x0},
+ 1136: {region: 0x165, script: 0x57, flags: 0x0},
+ 1137: {region: 0x6d, script: 0x29, flags: 0x0},
+ 1138: {region: 0x165, script: 0x57, flags: 0x0},
+ 1139: {region: 0x165, script: 0x57, flags: 0x0},
+ 1140: {region: 0x165, script: 0x57, flags: 0x0},
+ 1141: {region: 0xd6, script: 0x57, flags: 0x0},
+ 1142: {region: 0x127, script: 0x57, flags: 0x0},
+ 1143: {region: 0x125, script: 0x57, flags: 0x0},
+ 1144: {region: 0x32, script: 0x57, flags: 0x0},
+ 1145: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1146: {region: 0xe7, script: 0x57, flags: 0x0},
+ 1147: {region: 0x165, script: 0x57, flags: 0x0},
+ 1148: {region: 0x165, script: 0x57, flags: 0x0},
+ 1149: {region: 0x32, script: 0x57, flags: 0x0},
+ 1150: {region: 0xd4, script: 0x57, flags: 0x0},
+ 1151: {region: 0x165, script: 0x57, flags: 0x0},
+ 1152: {region: 0x161, script: 0x57, flags: 0x0},
+ 1153: {region: 0x165, script: 0x57, flags: 0x0},
+ 1154: {region: 0x129, script: 0x57, flags: 0x0},
+ 1155: {region: 0x165, script: 0x57, flags: 0x0},
+ 1156: {region: 0xce, script: 0x57, flags: 0x0},
+ 1157: {region: 0x165, script: 0x57, flags: 0x0},
+ 1158: {region: 0xe6, script: 0x57, flags: 0x0},
+ 1159: {region: 0x165, script: 0x57, flags: 0x0},
+ 1160: {region: 0x165, script: 0x57, flags: 0x0},
+ 1161: {region: 0x165, script: 0x57, flags: 0x0},
+ 1162: {region: 0x12b, script: 0x57, flags: 0x0},
+ 1163: {region: 0x12b, script: 0x57, flags: 0x0},
+ 1164: {region: 0x12e, script: 0x57, flags: 0x0},
+ 1165: {region: 0x165, script: 0x5, flags: 0x0},
+ 1166: {region: 0x161, script: 0x57, flags: 0x0},
+ 1167: {region: 0x87, script: 0x31, flags: 0x0},
+ 1168: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1169: {region: 0xe7, script: 0x57, flags: 0x0},
+ 1170: {region: 0x43, script: 0xe0, flags: 0x0},
+ 1171: {region: 0x165, script: 0x57, flags: 0x0},
+ 1172: {region: 0x106, script: 0x1f, flags: 0x0},
+ 1173: {region: 0x165, script: 0x57, flags: 0x0},
+ 1174: {region: 0x165, script: 0x57, flags: 0x0},
+ 1175: {region: 0x131, script: 0x57, flags: 0x0},
+ 1176: {region: 0x165, script: 0x57, flags: 0x0},
+ 1177: {region: 0x123, script: 0xdf, flags: 0x0},
+ 1178: {region: 0x32, script: 0x57, flags: 0x0},
+ 1179: {region: 0x165, script: 0x57, flags: 0x0},
+ 1180: {region: 0x165, script: 0x57, flags: 0x0},
+ 1181: {region: 0xce, script: 0x57, flags: 0x0},
+ 1182: {region: 0x165, script: 0x57, flags: 0x0},
+ 1183: {region: 0x165, script: 0x57, flags: 0x0},
+ 1184: {region: 0x12d, script: 0x57, flags: 0x0},
+ 1185: {region: 0x165, script: 0x57, flags: 0x0},
+ 1187: {region: 0x165, script: 0x57, flags: 0x0},
+ 1188: {region: 0xd4, script: 0x57, flags: 0x0},
+ 1189: {region: 0x53, script: 0xd8, flags: 0x0},
+ 1190: {region: 0xe5, script: 0x57, flags: 0x0},
+ 1191: {region: 0x165, script: 0x57, flags: 0x0},
+ 1192: {region: 0x106, script: 0x1f, flags: 0x0},
+ 1193: {region: 0xba, script: 0x57, flags: 0x0},
+ 1194: {region: 0x165, script: 0x57, flags: 0x0},
+ 1195: {region: 0x106, script: 0x1f, flags: 0x0},
+ 1196: {region: 0x3f, script: 0x4, flags: 0x1},
+ 1197: {region: 0x11c, script: 0xe2, flags: 0x0},
+ 1198: {region: 0x130, script: 0x1f, flags: 0x0},
+ 1199: {region: 0x75, script: 0x57, flags: 0x0},
+ 1200: {region: 0x2a, script: 0x57, flags: 0x0},
+ 1202: {region: 0x43, script: 0x3, flags: 0x1},
+ 1203: {region: 0x99, script: 0xe, flags: 0x0},
+ 1204: {region: 0xe8, script: 0x5, flags: 0x0},
+ 1205: {region: 0x165, script: 0x57, flags: 0x0},
+ 1206: {region: 0x165, script: 0x57, flags: 0x0},
+ 1207: {region: 0x165, script: 0x57, flags: 0x0},
+ 1208: {region: 0x165, script: 0x57, flags: 0x0},
+ 1209: {region: 0x165, script: 0x57, flags: 0x0},
+ 1210: {region: 0x165, script: 0x57, flags: 0x0},
+ 1211: {region: 0x165, script: 0x57, flags: 0x0},
+ 1212: {region: 0x46, script: 0x4, flags: 0x1},
+ 1213: {region: 0x165, script: 0x57, flags: 0x0},
+ 1214: {region: 0xb4, script: 0xe3, flags: 0x0},
+ 1215: {region: 0x165, script: 0x57, flags: 0x0},
+ 1216: {region: 0x161, script: 0x57, flags: 0x0},
+ 1217: {region: 0x9e, script: 0x57, flags: 0x0},
+ 1218: {region: 0x106, script: 0x57, flags: 0x0},
+ 1219: {region: 0x13e, script: 0x57, flags: 0x0},
+ 1220: {region: 0x11b, script: 0x57, flags: 0x0},
+ 1221: {region: 0x165, script: 0x57, flags: 0x0},
+ 1222: {region: 0x36, script: 0x57, flags: 0x0},
+ 1223: {region: 0x60, script: 0x57, flags: 0x0},
+ 1224: {region: 0xd1, script: 0x57, flags: 0x0},
+ 1225: {region: 0x1, script: 0x57, flags: 0x0},
+ 1226: {region: 0x106, script: 0x57, flags: 0x0},
+ 1227: {region: 0x6a, script: 0x57, flags: 0x0},
+ 1228: {region: 0x12f, script: 0x57, flags: 0x0},
+ 1229: {region: 0x165, script: 0x57, flags: 0x0},
+ 1230: {region: 0x36, script: 0x57, flags: 0x0},
+ 1231: {region: 0x4e, script: 0x57, flags: 0x0},
+ 1232: {region: 0x165, script: 0x57, flags: 0x0},
+ 1233: {region: 0x6f, script: 0x29, flags: 0x0},
+ 1234: {region: 0x165, script: 0x57, flags: 0x0},
+ 1235: {region: 0xe7, script: 0x57, flags: 0x0},
+ 1236: {region: 0x2f, script: 0x57, flags: 0x0},
+ 1237: {region: 0x99, script: 0xda, flags: 0x0},
+ 1238: {region: 0x99, script: 0x21, flags: 0x0},
+ 1239: {region: 0x165, script: 0x57, flags: 0x0},
+ 1240: {region: 0x165, script: 0x57, flags: 0x0},
+ 1241: {region: 0x165, script: 0x57, flags: 0x0},
+ 1242: {region: 0x165, script: 0x57, flags: 0x0},
+ 1243: {region: 0x165, script: 0x57, flags: 0x0},
+ 1244: {region: 0x165, script: 0x57, flags: 0x0},
+ 1245: {region: 0x165, script: 0x57, flags: 0x0},
+ 1246: {region: 0x165, script: 0x57, flags: 0x0},
+ 1247: {region: 0x165, script: 0x57, flags: 0x0},
+ 1248: {region: 0x140, script: 0x57, flags: 0x0},
+ 1249: {region: 0x165, script: 0x57, flags: 0x0},
+ 1250: {region: 0x165, script: 0x57, flags: 0x0},
+ 1251: {region: 0xa8, script: 0x5, flags: 0x0},
+ 1252: {region: 0x165, script: 0x57, flags: 0x0},
+ 1253: {region: 0x114, script: 0x57, flags: 0x0},
+ 1254: {region: 0x165, script: 0x57, flags: 0x0},
+ 1255: {region: 0x165, script: 0x57, flags: 0x0},
+ 1256: {region: 0x165, script: 0x57, flags: 0x0},
+ 1257: {region: 0x165, script: 0x57, flags: 0x0},
+ 1258: {region: 0x99, script: 0x21, flags: 0x0},
+ 1259: {region: 0x53, script: 0x38, flags: 0x0},
+ 1260: {region: 0x165, script: 0x57, flags: 0x0},
+ 1261: {region: 0x165, script: 0x57, flags: 0x0},
+ 1262: {region: 0x41, script: 0x57, flags: 0x0},
+ 1263: {region: 0x165, script: 0x57, flags: 0x0},
+ 1264: {region: 0x12b, script: 0x18, flags: 0x0},
+ 1265: {region: 0x165, script: 0x57, flags: 0x0},
+ 1266: {region: 0x161, script: 0x57, flags: 0x0},
+ 1267: {region: 0x165, script: 0x57, flags: 0x0},
+ 1268: {region: 0x12b, script: 0x5f, flags: 0x0},
+ 1269: {region: 0x12b, script: 0x60, flags: 0x0},
+ 1270: {region: 0x7d, script: 0x2b, flags: 0x0},
+ 1271: {region: 0x53, script: 0x64, flags: 0x0},
+ 1272: {region: 0x10b, script: 0x69, flags: 0x0},
+ 1273: {region: 0x108, script: 0x73, flags: 0x0},
+ 1274: {region: 0x99, script: 0x21, flags: 0x0},
+ 1275: {region: 0x131, script: 0x57, flags: 0x0},
+ 1276: {region: 0x165, script: 0x57, flags: 0x0},
+ 1277: {region: 0x9c, script: 0x8a, flags: 0x0},
+ 1278: {region: 0x165, script: 0x57, flags: 0x0},
+ 1279: {region: 0x15e, script: 0xc2, flags: 0x0},
+ 1280: {region: 0x165, script: 0x57, flags: 0x0},
+ 1281: {region: 0x165, script: 0x57, flags: 0x0},
+ 1282: {region: 0xdb, script: 0x21, flags: 0x0},
+ 1283: {region: 0x165, script: 0x57, flags: 0x0},
+ 1284: {region: 0x165, script: 0x57, flags: 0x0},
+ 1285: {region: 0xd1, script: 0x57, flags: 0x0},
+ 1286: {region: 0x75, script: 0x57, flags: 0x0},
+ 1287: {region: 0x165, script: 0x57, flags: 0x0},
+ 1288: {region: 0x165, script: 0x57, flags: 0x0},
+ 1289: {region: 0x52, script: 0x57, flags: 0x0},
+ 1290: {region: 0x165, script: 0x57, flags: 0x0},
+ 1291: {region: 0x165, script: 0x57, flags: 0x0},
+ 1292: {region: 0x165, script: 0x57, flags: 0x0},
+ 1293: {region: 0x52, script: 0x57, flags: 0x0},
+ 1294: {region: 0x165, script: 0x57, flags: 0x0},
+ 1295: {region: 0x165, script: 0x57, flags: 0x0},
+ 1296: {region: 0x165, script: 0x57, flags: 0x0},
+ 1297: {region: 0x165, script: 0x57, flags: 0x0},
+ 1298: {region: 0x1, script: 0x3b, flags: 0x0},
+ 1299: {region: 0x165, script: 0x57, flags: 0x0},
+ 1300: {region: 0x165, script: 0x57, flags: 0x0},
+ 1301: {region: 0x165, script: 0x57, flags: 0x0},
+ 1302: {region: 0x165, script: 0x57, flags: 0x0},
+ 1303: {region: 0x165, script: 0x57, flags: 0x0},
+ 1304: {region: 0xd6, script: 0x57, flags: 0x0},
+ 1305: {region: 0x165, script: 0x57, flags: 0x0},
+ 1306: {region: 0x165, script: 0x57, flags: 0x0},
+ 1307: {region: 0x165, script: 0x57, flags: 0x0},
+ 1308: {region: 0x41, script: 0x57, flags: 0x0},
+ 1309: {region: 0x165, script: 0x57, flags: 0x0},
+ 1310: {region: 0xcf, script: 0x57, flags: 0x0},
+ 1311: {region: 0x4a, script: 0x3, flags: 0x1},
+ 1312: {region: 0x165, script: 0x57, flags: 0x0},
+ 1313: {region: 0x165, script: 0x57, flags: 0x0},
+ 1314: {region: 0x165, script: 0x57, flags: 0x0},
+ 1315: {region: 0x53, script: 0x57, flags: 0x0},
+ 1316: {region: 0x10b, script: 0x57, flags: 0x0},
+ 1318: {region: 0xa8, script: 0x5, flags: 0x0},
+ 1319: {region: 0xd9, script: 0x57, flags: 0x0},
+ 1320: {region: 0xba, script: 0xdc, flags: 0x0},
+ 1321: {region: 0x4d, script: 0x14, flags: 0x1},
+ 1322: {region: 0x53, script: 0x79, flags: 0x0},
+ 1323: {region: 0x165, script: 0x57, flags: 0x0},
+ 1324: {region: 0x122, script: 0x57, flags: 0x0},
+ 1325: {region: 0xd0, script: 0x57, flags: 0x0},
+ 1326: {region: 0x165, script: 0x57, flags: 0x0},
+ 1327: {region: 0x161, script: 0x57, flags: 0x0},
+ 1329: {region: 0x12b, script: 0x57, flags: 0x0},
+}
+
+// likelyLangList holds lists info associated with likelyLang.
+// Size: 388 bytes, 97 elements
+var likelyLangList = [97]likelyScriptRegion{
+ 0: {region: 0x9c, script: 0x7, flags: 0x0},
+ 1: {region: 0xa1, script: 0x74, flags: 0x2},
+ 2: {region: 0x11c, script: 0x80, flags: 0x2},
+ 3: {region: 0x32, script: 0x57, flags: 0x0},
+ 4: {region: 0x9b, script: 0x5, flags: 0x4},
+ 5: {region: 0x9c, script: 0x5, flags: 0x4},
+ 6: {region: 0x106, script: 0x1f, flags: 0x4},
+ 7: {region: 0x9c, script: 0x5, flags: 0x2},
+ 8: {region: 0x106, script: 0x1f, flags: 0x0},
+ 9: {region: 0x38, script: 0x2c, flags: 0x2},
+ 10: {region: 0x135, script: 0x57, flags: 0x0},
+ 11: {region: 0x7b, script: 0xc5, flags: 0x2},
+ 12: {region: 0x114, script: 0x57, flags: 0x0},
+ 13: {region: 0x84, script: 0x1, flags: 0x2},
+ 14: {region: 0x5d, script: 0x1e, flags: 0x0},
+ 15: {region: 0x87, script: 0x5c, flags: 0x2},
+ 16: {region: 0xd6, script: 0x57, flags: 0x0},
+ 17: {region: 0x52, script: 0x5, flags: 0x4},
+ 18: {region: 0x10b, script: 0x5, flags: 0x4},
+ 19: {region: 0xae, script: 0x1f, flags: 0x0},
+ 20: {region: 0x24, script: 0x5, flags: 0x4},
+ 21: {region: 0x53, script: 0x5, flags: 0x4},
+ 22: {region: 0x9c, script: 0x5, flags: 0x4},
+ 23: {region: 0xc5, script: 0x5, flags: 0x4},
+ 24: {region: 0x53, script: 0x5, flags: 0x2},
+ 25: {region: 0x12b, script: 0x57, flags: 0x0},
+ 26: {region: 0xb0, script: 0x5, flags: 0x4},
+ 27: {region: 0x9b, script: 0x5, flags: 0x2},
+ 28: {region: 0xa5, script: 0x1f, flags: 0x0},
+ 29: {region: 0x53, script: 0x5, flags: 0x4},
+ 30: {region: 0x12b, script: 0x57, flags: 0x4},
+ 31: {region: 0x53, script: 0x5, flags: 0x2},
+ 32: {region: 0x12b, script: 0x57, flags: 0x2},
+ 33: {region: 0xdb, script: 0x21, flags: 0x0},
+ 34: {region: 0x99, script: 0x5a, flags: 0x2},
+ 35: {region: 0x83, script: 0x57, flags: 0x0},
+ 36: {region: 0x84, script: 0x78, flags: 0x4},
+ 37: {region: 0x84, script: 0x78, flags: 0x2},
+ 38: {region: 0xc5, script: 0x1f, flags: 0x0},
+ 39: {region: 0x53, script: 0x6d, flags: 0x4},
+ 40: {region: 0x53, script: 0x6d, flags: 0x2},
+ 41: {region: 0xd0, script: 0x57, flags: 0x0},
+ 42: {region: 0x4a, script: 0x5, flags: 0x4},
+ 43: {region: 0x95, script: 0x5, flags: 0x4},
+ 44: {region: 0x99, script: 0x33, flags: 0x0},
+ 45: {region: 0xe8, script: 0x5, flags: 0x4},
+ 46: {region: 0xe8, script: 0x5, flags: 0x2},
+ 47: {region: 0x9c, script: 0x84, flags: 0x0},
+ 48: {region: 0x53, script: 0x85, flags: 0x2},
+ 49: {region: 0xba, script: 0xdc, flags: 0x0},
+ 50: {region: 0xd9, script: 0x57, flags: 0x4},
+ 51: {region: 0xe8, script: 0x5, flags: 0x0},
+ 52: {region: 0x99, script: 0x21, flags: 0x2},
+ 53: {region: 0x99, script: 0x4c, flags: 0x2},
+ 54: {region: 0x99, script: 0xc9, flags: 0x2},
+ 55: {region: 0x105, script: 0x1f, flags: 0x0},
+ 56: {region: 0xbd, script: 0x57, flags: 0x4},
+ 57: {region: 0x104, script: 0x57, flags: 0x4},
+ 58: {region: 0x106, script: 0x57, flags: 0x4},
+ 59: {region: 0x12b, script: 0x57, flags: 0x4},
+ 60: {region: 0x124, script: 0x1f, flags: 0x0},
+ 61: {region: 0xe8, script: 0x5, flags: 0x4},
+ 62: {region: 0xe8, script: 0x5, flags: 0x2},
+ 63: {region: 0x53, script: 0x5, flags: 0x0},
+ 64: {region: 0xae, script: 0x1f, flags: 0x4},
+ 65: {region: 0xc5, script: 0x1f, flags: 0x4},
+ 66: {region: 0xae, script: 0x1f, flags: 0x2},
+ 67: {region: 0x99, script: 0xe, flags: 0x0},
+ 68: {region: 0xdb, script: 0x21, flags: 0x4},
+ 69: {region: 0xdb, script: 0x21, flags: 0x2},
+ 70: {region: 0x137, script: 0x57, flags: 0x0},
+ 71: {region: 0x24, script: 0x5, flags: 0x4},
+ 72: {region: 0x53, script: 0x1f, flags: 0x4},
+ 73: {region: 0x24, script: 0x5, flags: 0x2},
+ 74: {region: 0x8d, script: 0x39, flags: 0x0},
+ 75: {region: 0x53, script: 0x38, flags: 0x4},
+ 76: {region: 0x53, script: 0x38, flags: 0x2},
+ 77: {region: 0x53, script: 0x38, flags: 0x0},
+ 78: {region: 0x2f, script: 0x39, flags: 0x4},
+ 79: {region: 0x3e, script: 0x39, flags: 0x4},
+ 80: {region: 0x7b, script: 0x39, flags: 0x4},
+ 81: {region: 0x7e, script: 0x39, flags: 0x4},
+ 82: {region: 0x8d, script: 0x39, flags: 0x4},
+ 83: {region: 0x95, script: 0x39, flags: 0x4},
+ 84: {region: 0xc6, script: 0x39, flags: 0x4},
+ 85: {region: 0xd0, script: 0x39, flags: 0x4},
+ 86: {region: 0xe2, script: 0x39, flags: 0x4},
+ 87: {region: 0xe5, script: 0x39, flags: 0x4},
+ 88: {region: 0xe7, script: 0x39, flags: 0x4},
+ 89: {region: 0x116, script: 0x39, flags: 0x4},
+ 90: {region: 0x123, script: 0x39, flags: 0x4},
+ 91: {region: 0x12e, script: 0x39, flags: 0x4},
+ 92: {region: 0x135, script: 0x39, flags: 0x4},
+ 93: {region: 0x13e, script: 0x39, flags: 0x4},
+ 94: {region: 0x12e, script: 0x11, flags: 0x2},
+ 95: {region: 0x12e, script: 0x34, flags: 0x2},
+ 96: {region: 0x12e, script: 0x39, flags: 0x2},
+}
+
+type likelyLangScript struct {
+ lang uint16
+ script uint8
+ flags uint8
+}
+
+// likelyRegion is a lookup table, indexed by regionID, for the most likely
+// languages and scripts given incomplete information. If more entries exist
+// for a given regionID, lang and script are the index and size respectively
+// of the list in likelyRegionList.
+// TODO: exclude containers and user-definable regions from the list.
+// Size: 1432 bytes, 358 elements
+var likelyRegion = [358]likelyLangScript{
+ 34: {lang: 0xd7, script: 0x57, flags: 0x0},
+ 35: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 36: {lang: 0x0, script: 0x2, flags: 0x1},
+ 39: {lang: 0x2, script: 0x2, flags: 0x1},
+ 40: {lang: 0x4, script: 0x2, flags: 0x1},
+ 42: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 43: {lang: 0x0, script: 0x57, flags: 0x0},
+ 44: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 45: {lang: 0x41b, script: 0x57, flags: 0x0},
+ 46: {lang: 0x10d, script: 0x57, flags: 0x0},
+ 48: {lang: 0x367, script: 0x57, flags: 0x0},
+ 49: {lang: 0x444, script: 0x57, flags: 0x0},
+ 50: {lang: 0x58, script: 0x57, flags: 0x0},
+ 51: {lang: 0x6, script: 0x2, flags: 0x1},
+ 53: {lang: 0xa5, script: 0xe, flags: 0x0},
+ 54: {lang: 0x367, script: 0x57, flags: 0x0},
+ 55: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 56: {lang: 0x7e, script: 0x1f, flags: 0x0},
+ 57: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 58: {lang: 0x3d9, script: 0x57, flags: 0x0},
+ 59: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 60: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 62: {lang: 0x31f, script: 0x57, flags: 0x0},
+ 63: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 64: {lang: 0x3a1, script: 0x57, flags: 0x0},
+ 65: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 67: {lang: 0x8, script: 0x2, flags: 0x1},
+ 69: {lang: 0x0, script: 0x57, flags: 0x0},
+ 71: {lang: 0x71, script: 0x1f, flags: 0x0},
+ 73: {lang: 0x512, script: 0x3b, flags: 0x2},
+ 74: {lang: 0x31f, script: 0x5, flags: 0x2},
+ 75: {lang: 0x445, script: 0x57, flags: 0x0},
+ 76: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 77: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 78: {lang: 0x10d, script: 0x57, flags: 0x0},
+ 79: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 81: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 82: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 83: {lang: 0xa, script: 0x4, flags: 0x1},
+ 84: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 85: {lang: 0x0, script: 0x57, flags: 0x0},
+ 86: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 89: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 90: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 91: {lang: 0x3a1, script: 0x57, flags: 0x0},
+ 93: {lang: 0xe, script: 0x2, flags: 0x1},
+ 94: {lang: 0xfa, script: 0x57, flags: 0x0},
+ 96: {lang: 0x10d, script: 0x57, flags: 0x0},
+ 98: {lang: 0x1, script: 0x57, flags: 0x0},
+ 99: {lang: 0x101, script: 0x57, flags: 0x0},
+ 101: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 103: {lang: 0x10, script: 0x2, flags: 0x1},
+ 104: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 105: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 106: {lang: 0x140, script: 0x57, flags: 0x0},
+ 107: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 108: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 109: {lang: 0x46f, script: 0x29, flags: 0x0},
+ 110: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 111: {lang: 0x12, script: 0x2, flags: 0x1},
+ 113: {lang: 0x10d, script: 0x57, flags: 0x0},
+ 114: {lang: 0x151, script: 0x57, flags: 0x0},
+ 115: {lang: 0x1c0, script: 0x21, flags: 0x2},
+ 118: {lang: 0x158, script: 0x57, flags: 0x0},
+ 120: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 122: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 123: {lang: 0x14, script: 0x2, flags: 0x1},
+ 125: {lang: 0x16, script: 0x3, flags: 0x1},
+ 126: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 128: {lang: 0x21, script: 0x57, flags: 0x0},
+ 130: {lang: 0x245, script: 0x57, flags: 0x0},
+ 132: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 133: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 134: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 135: {lang: 0x19, script: 0x2, flags: 0x1},
+ 136: {lang: 0x0, script: 0x57, flags: 0x0},
+ 137: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 139: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 141: {lang: 0x529, script: 0x39, flags: 0x0},
+ 142: {lang: 0x0, script: 0x57, flags: 0x0},
+ 143: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 144: {lang: 0x1d1, script: 0x57, flags: 0x0},
+ 145: {lang: 0x1d4, script: 0x57, flags: 0x0},
+ 146: {lang: 0x1d5, script: 0x57, flags: 0x0},
+ 148: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 149: {lang: 0x1b, script: 0x2, flags: 0x1},
+ 151: {lang: 0x1bc, script: 0x3b, flags: 0x0},
+ 153: {lang: 0x1d, script: 0x3, flags: 0x1},
+ 155: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 156: {lang: 0x20, script: 0x2, flags: 0x1},
+ 157: {lang: 0x1f8, script: 0x57, flags: 0x0},
+ 158: {lang: 0x1f9, script: 0x57, flags: 0x0},
+ 161: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 162: {lang: 0x200, script: 0x46, flags: 0x0},
+ 164: {lang: 0x445, script: 0x57, flags: 0x0},
+ 165: {lang: 0x28a, script: 0x1f, flags: 0x0},
+ 166: {lang: 0x22, script: 0x3, flags: 0x1},
+ 168: {lang: 0x25, script: 0x2, flags: 0x1},
+ 170: {lang: 0x254, script: 0x50, flags: 0x0},
+ 171: {lang: 0x254, script: 0x50, flags: 0x0},
+ 172: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 174: {lang: 0x3e2, script: 0x1f, flags: 0x0},
+ 175: {lang: 0x27, script: 0x2, flags: 0x1},
+ 176: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 178: {lang: 0x10d, script: 0x57, flags: 0x0},
+ 179: {lang: 0x40c, script: 0xca, flags: 0x0},
+ 181: {lang: 0x43b, script: 0x57, flags: 0x0},
+ 182: {lang: 0x2c0, script: 0x57, flags: 0x0},
+ 183: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 184: {lang: 0x2c7, script: 0x57, flags: 0x0},
+ 185: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 186: {lang: 0x29, script: 0x2, flags: 0x1},
+ 187: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 188: {lang: 0x2b, script: 0x2, flags: 0x1},
+ 189: {lang: 0x432, script: 0x57, flags: 0x0},
+ 190: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 191: {lang: 0x2f1, script: 0x57, flags: 0x0},
+ 194: {lang: 0x2d, script: 0x2, flags: 0x1},
+ 195: {lang: 0xa0, script: 0x57, flags: 0x0},
+ 196: {lang: 0x2f, script: 0x2, flags: 0x1},
+ 197: {lang: 0x31, script: 0x2, flags: 0x1},
+ 198: {lang: 0x33, script: 0x2, flags: 0x1},
+ 200: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 201: {lang: 0x35, script: 0x2, flags: 0x1},
+ 203: {lang: 0x320, script: 0x57, flags: 0x0},
+ 204: {lang: 0x37, script: 0x3, flags: 0x1},
+ 205: {lang: 0x128, script: 0xde, flags: 0x0},
+ 207: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 208: {lang: 0x31f, script: 0x57, flags: 0x0},
+ 209: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 210: {lang: 0x16, script: 0x57, flags: 0x0},
+ 211: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 212: {lang: 0x1b4, script: 0x57, flags: 0x0},
+ 214: {lang: 0x1b4, script: 0x5, flags: 0x2},
+ 216: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 217: {lang: 0x367, script: 0x57, flags: 0x0},
+ 218: {lang: 0x347, script: 0x57, flags: 0x0},
+ 219: {lang: 0x351, script: 0x21, flags: 0x0},
+ 225: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 226: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 228: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 229: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 230: {lang: 0x486, script: 0x57, flags: 0x0},
+ 231: {lang: 0x153, script: 0x57, flags: 0x0},
+ 232: {lang: 0x3a, script: 0x3, flags: 0x1},
+ 233: {lang: 0x3b3, script: 0x57, flags: 0x0},
+ 234: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 236: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 237: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 238: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 240: {lang: 0x3a2, script: 0x57, flags: 0x0},
+ 241: {lang: 0x194, script: 0x57, flags: 0x0},
+ 243: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 258: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 260: {lang: 0x3d, script: 0x2, flags: 0x1},
+ 261: {lang: 0x432, script: 0x1f, flags: 0x0},
+ 262: {lang: 0x3f, script: 0x2, flags: 0x1},
+ 263: {lang: 0x3e5, script: 0x57, flags: 0x0},
+ 264: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 266: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 267: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 268: {lang: 0x41, script: 0x2, flags: 0x1},
+ 271: {lang: 0x416, script: 0x57, flags: 0x0},
+ 272: {lang: 0x347, script: 0x57, flags: 0x0},
+ 273: {lang: 0x43, script: 0x2, flags: 0x1},
+ 275: {lang: 0x1f9, script: 0x57, flags: 0x0},
+ 276: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 277: {lang: 0x429, script: 0x57, flags: 0x0},
+ 278: {lang: 0x367, script: 0x57, flags: 0x0},
+ 280: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 282: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 284: {lang: 0x45, script: 0x2, flags: 0x1},
+ 288: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 289: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 290: {lang: 0x47, script: 0x2, flags: 0x1},
+ 291: {lang: 0x49, script: 0x3, flags: 0x1},
+ 292: {lang: 0x4c, script: 0x2, flags: 0x1},
+ 293: {lang: 0x477, script: 0x57, flags: 0x0},
+ 294: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 295: {lang: 0x476, script: 0x57, flags: 0x0},
+ 296: {lang: 0x4e, script: 0x2, flags: 0x1},
+ 297: {lang: 0x482, script: 0x57, flags: 0x0},
+ 299: {lang: 0x50, script: 0x4, flags: 0x1},
+ 301: {lang: 0x4a0, script: 0x57, flags: 0x0},
+ 302: {lang: 0x54, script: 0x2, flags: 0x1},
+ 303: {lang: 0x445, script: 0x57, flags: 0x0},
+ 304: {lang: 0x56, script: 0x3, flags: 0x1},
+ 305: {lang: 0x445, script: 0x57, flags: 0x0},
+ 309: {lang: 0x512, script: 0x3b, flags: 0x2},
+ 310: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 311: {lang: 0x4bc, script: 0x57, flags: 0x0},
+ 312: {lang: 0x1f9, script: 0x57, flags: 0x0},
+ 315: {lang: 0x13e, script: 0x57, flags: 0x0},
+ 318: {lang: 0x4c3, script: 0x57, flags: 0x0},
+ 319: {lang: 0x8a, script: 0x57, flags: 0x0},
+ 320: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 322: {lang: 0x41b, script: 0x57, flags: 0x0},
+ 333: {lang: 0x59, script: 0x2, flags: 0x1},
+ 350: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 351: {lang: 0x5b, script: 0x2, flags: 0x1},
+ 356: {lang: 0x423, script: 0x57, flags: 0x0},
+}
+
+// likelyRegionList holds lists info associated with likelyRegion.
+// Size: 372 bytes, 93 elements
+var likelyRegionList = [93]likelyLangScript{
+ 0: {lang: 0x148, script: 0x5, flags: 0x0},
+ 1: {lang: 0x476, script: 0x57, flags: 0x0},
+ 2: {lang: 0x431, script: 0x57, flags: 0x0},
+ 3: {lang: 0x2ff, script: 0x1f, flags: 0x0},
+ 4: {lang: 0x1d7, script: 0x8, flags: 0x0},
+ 5: {lang: 0x274, script: 0x57, flags: 0x0},
+ 6: {lang: 0xb7, script: 0x57, flags: 0x0},
+ 7: {lang: 0x432, script: 0x1f, flags: 0x0},
+ 8: {lang: 0x12d, script: 0xe0, flags: 0x0},
+ 9: {lang: 0x351, script: 0x21, flags: 0x0},
+ 10: {lang: 0x529, script: 0x38, flags: 0x0},
+ 11: {lang: 0x4ac, script: 0x5, flags: 0x0},
+ 12: {lang: 0x523, script: 0x57, flags: 0x0},
+ 13: {lang: 0x29a, script: 0xdf, flags: 0x0},
+ 14: {lang: 0x136, script: 0x31, flags: 0x0},
+ 15: {lang: 0x48a, script: 0x57, flags: 0x0},
+ 16: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 17: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 18: {lang: 0x27, script: 0x29, flags: 0x0},
+ 19: {lang: 0x139, script: 0x57, flags: 0x0},
+ 20: {lang: 0x26a, script: 0x5, flags: 0x2},
+ 21: {lang: 0x512, script: 0x3b, flags: 0x2},
+ 22: {lang: 0x210, script: 0x2b, flags: 0x0},
+ 23: {lang: 0x5, script: 0x1f, flags: 0x0},
+ 24: {lang: 0x274, script: 0x57, flags: 0x0},
+ 25: {lang: 0x136, script: 0x31, flags: 0x0},
+ 26: {lang: 0x2ff, script: 0x1f, flags: 0x0},
+ 27: {lang: 0x1e1, script: 0x57, flags: 0x0},
+ 28: {lang: 0x31f, script: 0x5, flags: 0x0},
+ 29: {lang: 0x1be, script: 0x21, flags: 0x0},
+ 30: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 31: {lang: 0x236, script: 0x72, flags: 0x0},
+ 32: {lang: 0x148, script: 0x5, flags: 0x0},
+ 33: {lang: 0x476, script: 0x57, flags: 0x0},
+ 34: {lang: 0x24a, script: 0x4b, flags: 0x0},
+ 35: {lang: 0xe6, script: 0x5, flags: 0x0},
+ 36: {lang: 0x226, script: 0xdf, flags: 0x0},
+ 37: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 38: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 39: {lang: 0x2b8, script: 0x54, flags: 0x0},
+ 40: {lang: 0x226, script: 0xdf, flags: 0x0},
+ 41: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 42: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 43: {lang: 0x3dc, script: 0x57, flags: 0x0},
+ 44: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+ 45: {lang: 0x2ff, script: 0x1f, flags: 0x0},
+ 46: {lang: 0x431, script: 0x57, flags: 0x0},
+ 47: {lang: 0x331, script: 0x72, flags: 0x0},
+ 48: {lang: 0x213, script: 0x57, flags: 0x0},
+ 49: {lang: 0x30b, script: 0x1f, flags: 0x0},
+ 50: {lang: 0x242, script: 0x5, flags: 0x0},
+ 51: {lang: 0x529, script: 0x39, flags: 0x0},
+ 52: {lang: 0x3c0, script: 0x57, flags: 0x0},
+ 53: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 54: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 55: {lang: 0x2ed, script: 0x57, flags: 0x0},
+ 56: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 57: {lang: 0x88, script: 0x21, flags: 0x0},
+ 58: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 59: {lang: 0x4b4, script: 0x5, flags: 0x0},
+ 60: {lang: 0xbe, script: 0x21, flags: 0x0},
+ 61: {lang: 0x3dc, script: 0x57, flags: 0x0},
+ 62: {lang: 0x7e, script: 0x1f, flags: 0x0},
+ 63: {lang: 0x3e2, script: 0x1f, flags: 0x0},
+ 64: {lang: 0x267, script: 0x57, flags: 0x0},
+ 65: {lang: 0x444, script: 0x57, flags: 0x0},
+ 66: {lang: 0x512, script: 0x3b, flags: 0x0},
+ 67: {lang: 0x412, script: 0x57, flags: 0x0},
+ 68: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+ 69: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 70: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 71: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 72: {lang: 0x35, script: 0x5, flags: 0x0},
+ 73: {lang: 0x46b, script: 0xdf, flags: 0x0},
+ 74: {lang: 0x2ec, script: 0x5, flags: 0x0},
+ 75: {lang: 0x30f, script: 0x72, flags: 0x0},
+ 76: {lang: 0x467, script: 0x1f, flags: 0x0},
+ 77: {lang: 0x148, script: 0x5, flags: 0x0},
+ 78: {lang: 0x3a, script: 0x5, flags: 0x0},
+ 79: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 80: {lang: 0x48a, script: 0x57, flags: 0x0},
+ 81: {lang: 0x58, script: 0x5, flags: 0x0},
+ 82: {lang: 0x219, script: 0x1f, flags: 0x0},
+ 83: {lang: 0x81, script: 0x31, flags: 0x0},
+ 84: {lang: 0x529, script: 0x39, flags: 0x0},
+ 85: {lang: 0x48c, script: 0x57, flags: 0x0},
+ 86: {lang: 0x4ae, script: 0x1f, flags: 0x0},
+ 87: {lang: 0x512, script: 0x3b, flags: 0x0},
+ 88: {lang: 0x3b3, script: 0x57, flags: 0x0},
+ 89: {lang: 0x431, script: 0x57, flags: 0x0},
+ 90: {lang: 0x432, script: 0x1f, flags: 0x0},
+ 91: {lang: 0x15e, script: 0x57, flags: 0x0},
+ 92: {lang: 0x446, script: 0x5, flags: 0x0},
+}
+
+type likelyTag struct {
+ lang uint16
+ region uint16
+ script uint8
+}
+
+// Size: 198 bytes, 33 elements
+var likelyRegionGroup = [33]likelyTag{
+ 1: {lang: 0x139, region: 0xd6, script: 0x57},
+ 2: {lang: 0x139, region: 0x135, script: 0x57},
+ 3: {lang: 0x3c0, region: 0x41, script: 0x57},
+ 4: {lang: 0x139, region: 0x2f, script: 0x57},
+ 5: {lang: 0x139, region: 0xd6, script: 0x57},
+ 6: {lang: 0x13e, region: 0xcf, script: 0x57},
+ 7: {lang: 0x445, region: 0x12f, script: 0x57},
+ 8: {lang: 0x3a, region: 0x6b, script: 0x5},
+ 9: {lang: 0x445, region: 0x4b, script: 0x57},
+ 10: {lang: 0x139, region: 0x161, script: 0x57},
+ 11: {lang: 0x139, region: 0x135, script: 0x57},
+ 12: {lang: 0x139, region: 0x135, script: 0x57},
+ 13: {lang: 0x13e, region: 0x59, script: 0x57},
+ 14: {lang: 0x529, region: 0x53, script: 0x38},
+ 15: {lang: 0x1be, region: 0x99, script: 0x21},
+ 16: {lang: 0x1e1, region: 0x95, script: 0x57},
+ 17: {lang: 0x1f9, region: 0x9e, script: 0x57},
+ 18: {lang: 0x139, region: 0x2f, script: 0x57},
+ 19: {lang: 0x139, region: 0xe6, script: 0x57},
+ 20: {lang: 0x139, region: 0x8a, script: 0x57},
+ 21: {lang: 0x41b, region: 0x142, script: 0x57},
+ 22: {lang: 0x529, region: 0x53, script: 0x38},
+ 23: {lang: 0x4bc, region: 0x137, script: 0x57},
+ 24: {lang: 0x3a, region: 0x108, script: 0x5},
+ 25: {lang: 0x3e2, region: 0x106, script: 0x1f},
+ 26: {lang: 0x3e2, region: 0x106, script: 0x1f},
+ 27: {lang: 0x139, region: 0x7b, script: 0x57},
+ 28: {lang: 0x10d, region: 0x60, script: 0x57},
+ 29: {lang: 0x139, region: 0xd6, script: 0x57},
+ 30: {lang: 0x13e, region: 0x1f, script: 0x57},
+ 31: {lang: 0x139, region: 0x9a, script: 0x57},
+ 32: {lang: 0x139, region: 0x7b, script: 0x57},
+}
+
+// Size: 264 bytes, 33 elements
+var regionContainment = [33]uint64{
+ // Entry 0 - 1F
+ 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008,
+ 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080,
+ 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c,
+ 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000,
+ 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000,
+ 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000,
+ 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000,
+ 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000,
+ // Entry 20 - 3F
+ 0x0000000100000000,
+}
+
+// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
+// where each set holds all groupings that are directly connected in a region
+// containment graph.
+// Size: 358 bytes, 358 elements
+var regionInclusion = [358]uint8{
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
+ 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
+ 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
+ 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e,
+ 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23,
+ 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b,
+ 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d,
+ 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28,
+ // Entry 40 - 7F
+ 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33,
+ 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d,
+ 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23,
+ 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35,
+ 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39,
+ 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f,
+ 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21,
+ 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c,
+ // Entry 80 - BF
+ 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a,
+ 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34,
+ 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24,
+ 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c,
+ 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c,
+ 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31,
+ 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a,
+ 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f,
+ // Entry C0 - FF
+ 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c,
+ 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34,
+ 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21,
+ 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29,
+ 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31,
+ 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21,
+ 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+ // Entry 100 - 13F
+ 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f,
+ 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a,
+ 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f,
+ 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26,
+ 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d,
+ 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f,
+ 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d,
+ 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b,
+ // Entry 140 - 17F
+ 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
+ 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f,
+ 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
+}
+
+// regionInclusionBits is an array of bit vectors where every vector represents
+// a set of region groupings. These sets are used to compute the distance
+// between two regions for the purpose of language matching.
+// Size: 584 bytes, 73 elements
+var regionInclusionBits = [73]uint64{
+ // Entry 0 - 1F
+ 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808,
+ 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082,
+ 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d,
+ 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000,
+ 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010,
+ 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000,
+ 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000,
+ 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010,
+ // Entry 20 - 3F
+ 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000,
+ 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200,
+ 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000,
+ 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080,
+ 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000,
+ 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000,
+ 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000,
+ 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3,
+ // Entry 40 - 5F
+ 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813,
+ 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001,
+ 0x0000000102020001,
+}
+
+// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
+// all groups that are reachable from the groups set in the respective entry.
+// Size: 73 bytes, 73 elements
+var regionInclusionNext = [73]uint8{
+ // Entry 0 - 3F
+ 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01,
+ 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16,
+ 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16,
+ 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04,
+ 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09,
+ 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07,
+ 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46,
+ 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e,
+ // Entry 40 - 7F
+ 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43,
+ 0x43,
+}
+
+type parentRel struct {
+ lang uint16
+ script uint8
+ maxScript uint8
+ toRegion uint16
+ fromRegion []uint16
+}
+
+// Size: 414 bytes, 5 elements
+var parents = [5]parentRel{
+ 0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}},
+ 1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}},
+ 2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}},
+ 3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}},
+ 4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}},
+}
+
+// Total table size 25886 bytes (25KiB); checksum: 50D3D57D
diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go
new file mode 100644
index 00000000..e7afd318
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/language/tags.go
@@ -0,0 +1,48 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
+// It simplifies safe initialization of Tag values.
+func MustParse(s string) Tag {
+ t, err := Parse(s)
+ if err != nil {
+ panic(err)
+ }
+ return t
+}
+
+// MustParseBase is like ParseBase, but panics if the given base cannot be parsed.
+// It simplifies safe initialization of Base values.
+func MustParseBase(s string) Language {
+ b, err := ParseBase(s)
+ if err != nil {
+ panic(err)
+ }
+ return b
+}
+
+// MustParseScript is like ParseScript, but panics if the given script cannot be
+// parsed. It simplifies safe initialization of Script values.
+func MustParseScript(s string) Script {
+ scr, err := ParseScript(s)
+ if err != nil {
+ panic(err)
+ }
+ return scr
+}
+
+// MustParseRegion is like ParseRegion, but panics if the given region cannot be
+// parsed. It simplifies safe initialization of Region values.
+func MustParseRegion(s string) Region {
+ r, err := ParseRegion(s)
+ if err != nil {
+ panic(err)
+ }
+ return r
+}
+
+// Und is the root language.
+var Und Tag
diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go
new file mode 100644
index 00000000..b5d34889
--- /dev/null
+++ b/vendor/golang.org/x/text/internal/tag/tag.go
@@ -0,0 +1,100 @@
+// Copyright 2015 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package tag contains functionality handling tags and related data.
+package tag // import "golang.org/x/text/internal/tag"
+
+import "sort"
+
+// An Index converts tags to a compact numeric value.
+//
+// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can
+// be used to store additional information about the tag.
+type Index string
+
+// Elem returns the element data at the given index.
+func (s Index) Elem(x int) string {
+ return string(s[x*4 : x*4+4])
+}
+
+// Index reports the index of the given key or -1 if it could not be found.
+// Only the first len(key) bytes from the start of the 4-byte entries will be
+// considered for the search and the first match in Index will be returned.
+func (s Index) Index(key []byte) int {
+ n := len(key)
+ // search the index of the first entry with an equal or higher value than
+ // key in s.
+ index := sort.Search(len(s)/4, func(i int) bool {
+ return cmp(s[i*4:i*4+n], key) != -1
+ })
+ i := index * 4
+ if cmp(s[i:i+len(key)], key) != 0 {
+ return -1
+ }
+ return index
+}
+
+// Next finds the next occurrence of key after index x, which must have been
+// obtained from a call to Index using the same key. It returns x+1 or -1.
+func (s Index) Next(key []byte, x int) int {
+ if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 {
+ return x
+ }
+ return -1
+}
+
+// cmp returns an integer comparing a and b lexicographically.
+func cmp(a Index, b []byte) int {
+ n := len(a)
+ if len(b) < n {
+ n = len(b)
+ }
+ for i, c := range b[:n] {
+ switch {
+ case a[i] > c:
+ return 1
+ case a[i] < c:
+ return -1
+ }
+ }
+ switch {
+ case len(a) < len(b):
+ return -1
+ case len(a) > len(b):
+ return 1
+ }
+ return 0
+}
+
+// Compare returns an integer comparing a and b lexicographically.
+func Compare(a string, b []byte) int {
+ return cmp(Index(a), b)
+}
+
+// FixCase reformats b to the same pattern of cases as form.
+// If returns false if string b is malformed.
+func FixCase(form string, b []byte) bool {
+ if len(form) != len(b) {
+ return false
+ }
+ for i, c := range b {
+ if form[i] <= 'Z' {
+ if c >= 'a' {
+ c -= 'z' - 'Z'
+ }
+ if c < 'A' || 'Z' < c {
+ return false
+ }
+ } else {
+ if c <= 'Z' {
+ c += 'z' - 'Z'
+ }
+ if c < 'a' || 'z' < c {
+ return false
+ }
+ }
+ b[i] = c
+ }
+ return true
+}
diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go
new file mode 100644
index 00000000..a24fd1a4
--- /dev/null
+++ b/vendor/golang.org/x/text/language/coverage.go
@@ -0,0 +1,187 @@
+// Copyright 2014 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "fmt"
+ "sort"
+
+ "golang.org/x/text/internal/language"
+)
+
+// The Coverage interface is used to define the level of coverage of an
+// internationalization service. Note that not all types are supported by all
+// services. As lists may be generated on the fly, it is recommended that users
+// of a Coverage cache the results.
+type Coverage interface {
+ // Tags returns the list of supported tags.
+ Tags() []Tag
+
+ // BaseLanguages returns the list of supported base languages.
+ BaseLanguages() []Base
+
+ // Scripts returns the list of supported scripts.
+ Scripts() []Script
+
+ // Regions returns the list of supported regions.
+ Regions() []Region
+}
+
+var (
+ // Supported defines a Coverage that lists all supported subtags. Tags
+ // always returns nil.
+ Supported Coverage = allSubtags{}
+)
+
+// TODO:
+// - Support Variants, numbering systems.
+// - CLDR coverage levels.
+// - Set of common tags defined in this package.
+
+type allSubtags struct{}
+
+// Regions returns the list of supported regions. As all regions are in a
+// consecutive range, it simply returns a slice of numbers in increasing order.
+// The "undefined" region is not returned.
+func (s allSubtags) Regions() []Region {
+ reg := make([]Region, language.NumRegions)
+ for i := range reg {
+ reg[i] = Region{language.Region(i + 1)}
+ }
+ return reg
+}
+
+// Scripts returns the list of supported scripts. As all scripts are in a
+// consecutive range, it simply returns a slice of numbers in increasing order.
+// The "undefined" script is not returned.
+func (s allSubtags) Scripts() []Script {
+ scr := make([]Script, language.NumScripts)
+ for i := range scr {
+ scr[i] = Script{language.Script(i + 1)}
+ }
+ return scr
+}
+
+// BaseLanguages returns the list of all supported base languages. It generates
+// the list by traversing the internal structures.
+func (s allSubtags) BaseLanguages() []Base {
+ bs := language.BaseLanguages()
+ base := make([]Base, len(bs))
+ for i, b := range bs {
+ base[i] = Base{b}
+ }
+ return base
+}
+
+// Tags always returns nil.
+func (s allSubtags) Tags() []Tag {
+ return nil
+}
+
+// coverage is used by NewCoverage which is used as a convenient way for
+// creating Coverage implementations for partially defined data. Very often a
+// package will only need to define a subset of slices. coverage provides a
+// convenient way to do this. Moreover, packages using NewCoverage, instead of
+// their own implementation, will not break if later new slice types are added.
+type coverage struct {
+ tags func() []Tag
+ bases func() []Base
+ scripts func() []Script
+ regions func() []Region
+}
+
+func (s *coverage) Tags() []Tag {
+ if s.tags == nil {
+ return nil
+ }
+ return s.tags()
+}
+
+// bases implements sort.Interface and is used to sort base languages.
+type bases []Base
+
+func (b bases) Len() int {
+ return len(b)
+}
+
+func (b bases) Swap(i, j int) {
+ b[i], b[j] = b[j], b[i]
+}
+
+func (b bases) Less(i, j int) bool {
+ return b[i].langID < b[j].langID
+}
+
+// BaseLanguages returns the result from calling s.bases if it is specified or
+// otherwise derives the set of supported base languages from tags.
+func (s *coverage) BaseLanguages() []Base {
+ if s.bases == nil {
+ tags := s.Tags()
+ if len(tags) == 0 {
+ return nil
+ }
+ a := make([]Base, len(tags))
+ for i, t := range tags {
+ a[i] = Base{language.Language(t.lang())}
+ }
+ sort.Sort(bases(a))
+ k := 0
+ for i := 1; i < len(a); i++ {
+ if a[k] != a[i] {
+ k++
+ a[k] = a[i]
+ }
+ }
+ return a[:k+1]
+ }
+ return s.bases()
+}
+
+func (s *coverage) Scripts() []Script {
+ if s.scripts == nil {
+ return nil
+ }
+ return s.scripts()
+}
+
+func (s *coverage) Regions() []Region {
+ if s.regions == nil {
+ return nil
+ }
+ return s.regions()
+}
+
+// NewCoverage returns a Coverage for the given lists. It is typically used by
+// packages providing internationalization services to define their level of
+// coverage. A list may be of type []T or func() []T, where T is either Tag,
+// Base, Script or Region. The returned Coverage derives the value for Bases
+// from Tags if no func or slice for []Base is specified. For other unspecified
+// types the returned Coverage will return nil for the respective methods.
+func NewCoverage(list ...interface{}) Coverage {
+ s := &coverage{}
+ for _, x := range list {
+ switch v := x.(type) {
+ case func() []Base:
+ s.bases = v
+ case func() []Script:
+ s.scripts = v
+ case func() []Region:
+ s.regions = v
+ case func() []Tag:
+ s.tags = v
+ case []Base:
+ s.bases = func() []Base { return v }
+ case []Script:
+ s.scripts = func() []Script { return v }
+ case []Region:
+ s.regions = func() []Region { return v }
+ case []Tag:
+ s.tags = func() []Tag { return v }
+ default:
+ panic(fmt.Sprintf("language: unsupported set type %T", v))
+ }
+ }
+ return s
+}
diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go
new file mode 100644
index 00000000..8afecd50
--- /dev/null
+++ b/vendor/golang.org/x/text/language/doc.go
@@ -0,0 +1,102 @@
+// Copyright 2017 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package language implements BCP 47 language tags and related functionality.
+//
+// The most important function of package language is to match a list of
+// user-preferred languages to a list of supported languages.
+// It alleviates the developer of dealing with the complexity of this process
+// and provides the user with the best experience
+// (see https://blog.golang.org/matchlang).
+//
+//
+// Matching preferred against supported languages
+//
+// A Matcher for an application that supports English, Australian English,
+// Danish, and standard Mandarin can be created as follows:
+//
+// var matcher = language.NewMatcher([]language.Tag{
+// language.English, // The first language is used as fallback.
+// language.MustParse("en-AU"),
+// language.Danish,
+// language.Chinese,
+// })
+//
+// This list of supported languages is typically implied by the languages for
+// which there exists translations of the user interface.
+//
+// User-preferred languages usually come as a comma-separated list of BCP 47
+// language tags.
+// The MatchString finds best matches for such strings:
+//
+// handler(w http.ResponseWriter, r *http.Request) {
+// lang, _ := r.Cookie("lang")
+// accept := r.Header.Get("Accept-Language")
+// tag, _ := language.MatchStrings(matcher, lang.String(), accept)
+//
+// // tag should now be used for the initialization of any
+// // locale-specific service.
+// }
+//
+// The Matcher's Match method can be used to match Tags directly.
+//
+// Matchers are aware of the intricacies of equivalence between languages, such
+// as deprecated subtags, legacy tags, macro languages, mutual
+// intelligibility between scripts and languages, and transparently passing
+// BCP 47 user configuration.
+// For instance, it will know that a reader of Bokmål Danish can read Norwegian
+// and will know that Cantonese ("yue") is a good match for "zh-HK".
+//
+//
+// Using match results
+//
+// To guarantee a consistent user experience to the user it is important to
+// use the same language tag for the selection of any locale-specific services.
+// For example, it is utterly confusing to substitute spelled-out numbers
+// or dates in one language in text of another language.
+// More subtly confusing is using the wrong sorting order or casing
+// algorithm for a certain language.
+//
+// All the packages in x/text that provide locale-specific services
+// (e.g. collate, cases) should be initialized with the tag that was
+// obtained at the start of an interaction with the user.
+//
+// Note that Tag that is returned by Match and MatchString may differ from any
+// of the supported languages, as it may contain carried over settings from
+// the user tags.
+// This may be inconvenient when your application has some additional
+// locale-specific data for your supported languages.
+// Match and MatchString both return the index of the matched supported tag
+// to simplify associating such data with the matched tag.
+//
+//
+// Canonicalization
+//
+// If one uses the Matcher to compare languages one does not need to
+// worry about canonicalization.
+//
+// The meaning of a Tag varies per application. The language package
+// therefore delays canonicalization and preserves information as much
+// as possible. The Matcher, however, will always take into account that
+// two different tags may represent the same language.
+//
+// By default, only legacy and deprecated tags are converted into their
+// canonical equivalent. All other information is preserved. This approach makes
+// the confidence scores more accurate and allows matchers to distinguish
+// between variants that are otherwise lost.
+//
+// As a consequence, two tags that should be treated as identical according to
+// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The
+// Matcher handles such distinctions, though, and is aware of the
+// equivalence relations. The CanonType type can be used to alter the
+// canonicalization form.
+//
+// References
+//
+// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47
+//
+package language // import "golang.org/x/text/language"
+
+// TODO: explanation on how to match languages for your own locale-specific
+// service.
diff --git a/vendor/golang.org/x/text/language/go1_1.go b/vendor/golang.org/x/text/language/go1_1.go
new file mode 100644
index 00000000..380f4c09
--- /dev/null
+++ b/vendor/golang.org/x/text/language/go1_1.go
@@ -0,0 +1,38 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build !go1.2
+
+package language
+
+import "sort"
+
+func sortStable(s sort.Interface) {
+ ss := stableSort{
+ s: s,
+ pos: make([]int, s.Len()),
+ }
+ for i := range ss.pos {
+ ss.pos[i] = i
+ }
+ sort.Sort(&ss)
+}
+
+type stableSort struct {
+ s sort.Interface
+ pos []int
+}
+
+func (s *stableSort) Len() int {
+ return len(s.pos)
+}
+
+func (s *stableSort) Less(i, j int) bool {
+ return s.s.Less(i, j) || !s.s.Less(j, i) && s.pos[i] < s.pos[j]
+}
+
+func (s *stableSort) Swap(i, j int) {
+ s.s.Swap(i, j)
+ s.pos[i], s.pos[j] = s.pos[j], s.pos[i]
+}
diff --git a/vendor/golang.org/x/text/language/go1_2.go b/vendor/golang.org/x/text/language/go1_2.go
new file mode 100644
index 00000000..38268c57
--- /dev/null
+++ b/vendor/golang.org/x/text/language/go1_2.go
@@ -0,0 +1,11 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// +build go1.2
+
+package language
+
+import "sort"
+
+var sortStable = sort.Stable
diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go
new file mode 100644
index 00000000..abfa17f6
--- /dev/null
+++ b/vendor/golang.org/x/text/language/language.go
@@ -0,0 +1,601 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+//go:generate go run gen.go -output tables.go
+
+package language
+
+// TODO: Remove above NOTE after:
+// - verifying that tables are dropped correctly (most notably matcher tables).
+
+import (
+ "strings"
+
+ "golang.org/x/text/internal/language"
+ "golang.org/x/text/internal/language/compact"
+)
+
+// Tag represents a BCP 47 language tag. It is used to specify an instance of a
+// specific language or locale. All language tag values are guaranteed to be
+// well-formed.
+type Tag compact.Tag
+
+func makeTag(t language.Tag) (tag Tag) {
+ return Tag(compact.Make(t))
+}
+
+func (t *Tag) tag() language.Tag {
+ return (*compact.Tag)(t).Tag()
+}
+
+func (t *Tag) isCompact() bool {
+ return (*compact.Tag)(t).IsCompact()
+}
+
+// TODO: improve performance.
+func (t *Tag) lang() language.Language { return t.tag().LangID }
+func (t *Tag) region() language.Region { return t.tag().RegionID }
+func (t *Tag) script() language.Script { return t.tag().ScriptID }
+
+// Make is a convenience wrapper for Parse that omits the error.
+// In case of an error, a sensible default is returned.
+func Make(s string) Tag {
+ return Default.Make(s)
+}
+
+// Make is a convenience wrapper for c.Parse that omits the error.
+// In case of an error, a sensible default is returned.
+func (c CanonType) Make(s string) Tag {
+ t, _ := c.Parse(s)
+ return t
+}
+
+// Raw returns the raw base language, script and region, without making an
+// attempt to infer their values.
+func (t Tag) Raw() (b Base, s Script, r Region) {
+ tt := t.tag()
+ return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID}
+}
+
+// IsRoot returns true if t is equal to language "und".
+func (t Tag) IsRoot() bool {
+ return compact.Tag(t).IsRoot()
+}
+
+// CanonType can be used to enable or disable various types of canonicalization.
+type CanonType int
+
+const (
+ // Replace deprecated base languages with their preferred replacements.
+ DeprecatedBase CanonType = 1 << iota
+ // Replace deprecated scripts with their preferred replacements.
+ DeprecatedScript
+ // Replace deprecated regions with their preferred replacements.
+ DeprecatedRegion
+ // Remove redundant scripts.
+ SuppressScript
+ // Normalize legacy encodings. This includes legacy languages defined in
+ // CLDR as well as bibliographic codes defined in ISO-639.
+ Legacy
+ // Map the dominant language of a macro language group to the macro language
+ // subtag. For example cmn -> zh.
+ Macro
+ // The CLDR flag should be used if full compatibility with CLDR is required.
+ // There are a few cases where language.Tag may differ from CLDR. To follow all
+ // of CLDR's suggestions, use All|CLDR.
+ CLDR
+
+ // Raw can be used to Compose or Parse without Canonicalization.
+ Raw CanonType = 0
+
+ // Replace all deprecated tags with their preferred replacements.
+ Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion
+
+ // All canonicalizations recommended by BCP 47.
+ BCP47 = Deprecated | SuppressScript
+
+ // All canonicalizations.
+ All = BCP47 | Legacy | Macro
+
+ // Default is the canonicalization used by Parse, Make and Compose. To
+ // preserve as much information as possible, canonicalizations that remove
+ // potentially valuable information are not included. The Matcher is
+ // designed to recognize similar tags that would be the same if
+ // they were canonicalized using All.
+ Default = Deprecated | Legacy
+
+ canonLang = DeprecatedBase | Legacy | Macro
+
+ // TODO: LikelyScript, LikelyRegion: suppress similar to ICU.
+)
+
+// canonicalize returns the canonicalized equivalent of the tag and
+// whether there was any change.
+func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) {
+ if c == Raw {
+ return t, false
+ }
+ changed := false
+ if c&SuppressScript != 0 {
+ if t.LangID.SuppressScript() == t.ScriptID {
+ t.ScriptID = 0
+ changed = true
+ }
+ }
+ if c&canonLang != 0 {
+ for {
+ if l, aliasType := t.LangID.Canonicalize(); l != t.LangID {
+ switch aliasType {
+ case language.Legacy:
+ if c&Legacy != 0 {
+ if t.LangID == _sh && t.ScriptID == 0 {
+ t.ScriptID = _Latn
+ }
+ t.LangID = l
+ changed = true
+ }
+ case language.Macro:
+ if c&Macro != 0 {
+ // We deviate here from CLDR. The mapping "nb" -> "no"
+ // qualifies as a typical Macro language mapping. However,
+ // for legacy reasons, CLDR maps "no", the macro language
+ // code for Norwegian, to the dominant variant "nb". This
+ // change is currently under consideration for CLDR as well.
+ // See https://unicode.org/cldr/trac/ticket/2698 and also
+ // https://unicode.org/cldr/trac/ticket/1790 for some of the
+ // practical implications. TODO: this check could be removed
+ // if CLDR adopts this change.
+ if c&CLDR == 0 || t.LangID != _nb {
+ changed = true
+ t.LangID = l
+ }
+ }
+ case language.Deprecated:
+ if c&DeprecatedBase != 0 {
+ if t.LangID == _mo && t.RegionID == 0 {
+ t.RegionID = _MD
+ }
+ t.LangID = l
+ changed = true
+ // Other canonicalization types may still apply.
+ continue
+ }
+ }
+ } else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 {
+ t.LangID = _nb
+ changed = true
+ }
+ break
+ }
+ }
+ if c&DeprecatedScript != 0 {
+ if t.ScriptID == _Qaai {
+ changed = true
+ t.ScriptID = _Zinh
+ }
+ }
+ if c&DeprecatedRegion != 0 {
+ if r := t.RegionID.Canonicalize(); r != t.RegionID {
+ changed = true
+ t.RegionID = r
+ }
+ }
+ return t, changed
+}
+
+// Canonicalize returns the canonicalized equivalent of the tag.
+func (c CanonType) Canonicalize(t Tag) (Tag, error) {
+ // First try fast path.
+ if t.isCompact() {
+ if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed {
+ return t, nil
+ }
+ }
+ // It is unlikely that one will canonicalize a tag after matching. So do
+ // a slow but simple approach here.
+ if tag, changed := canonicalize(c, t.tag()); changed {
+ tag.RemakeString()
+ return makeTag(tag), nil
+ }
+ return t, nil
+
+}
+
+// Confidence indicates the level of certainty for a given return value.
+// For example, Serbian may be written in Cyrillic or Latin script.
+// The confidence level indicates whether a value was explicitly specified,
+// whether it is typically the only possible value, or whether there is
+// an ambiguity.
+type Confidence int
+
+const (
+ No Confidence = iota // full confidence that there was no match
+ Low // most likely value picked out of a set of alternatives
+ High // value is generally assumed to be the correct match
+ Exact // exact match or explicitly specified value
+)
+
+var confName = []string{"No", "Low", "High", "Exact"}
+
+func (c Confidence) String() string {
+ return confName[c]
+}
+
+// String returns the canonical string representation of the language tag.
+func (t Tag) String() string {
+ return t.tag().String()
+}
+
+// MarshalText implements encoding.TextMarshaler.
+func (t Tag) MarshalText() (text []byte, err error) {
+ return t.tag().MarshalText()
+}
+
+// UnmarshalText implements encoding.TextUnmarshaler.
+func (t *Tag) UnmarshalText(text []byte) error {
+ var tag language.Tag
+ err := tag.UnmarshalText(text)
+ *t = makeTag(tag)
+ return err
+}
+
+// Base returns the base language of the language tag. If the base language is
+// unspecified, an attempt will be made to infer it from the context.
+// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
+func (t Tag) Base() (Base, Confidence) {
+ if b := t.lang(); b != 0 {
+ return Base{b}, Exact
+ }
+ tt := t.tag()
+ c := High
+ if tt.ScriptID == 0 && !tt.RegionID.IsCountry() {
+ c = Low
+ }
+ if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 {
+ return Base{tag.LangID}, c
+ }
+ return Base{0}, No
+}
+
+// Script infers the script for the language tag. If it was not explicitly given, it will infer
+// a most likely candidate.
+// If more than one script is commonly used for a language, the most likely one
+// is returned with a low confidence indication. For example, it returns (Cyrl, Low)
+// for Serbian.
+// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined)
+// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks
+// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts.
+// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for
+// unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified.
+// Note that an inferred script is never guaranteed to be the correct one. Latin is
+// almost exclusively used for Afrikaans, but Arabic has been used for some texts
+// in the past. Also, the script that is commonly used may change over time.
+// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
+func (t Tag) Script() (Script, Confidence) {
+ if scr := t.script(); scr != 0 {
+ return Script{scr}, Exact
+ }
+ tt := t.tag()
+ sc, c := language.Script(_Zzzz), No
+ if scr := tt.LangID.SuppressScript(); scr != 0 {
+ // Note: it is not always the case that a language with a suppress
+ // script value is only written in one script (e.g. kk, ms, pa).
+ if tt.RegionID == 0 {
+ return Script{scr}, High
+ }
+ sc, c = scr, High
+ }
+ if tag, err := tt.Maximize(); err == nil {
+ if tag.ScriptID != sc {
+ sc, c = tag.ScriptID, Low
+ }
+ } else {
+ tt, _ = canonicalize(Deprecated|Macro, tt)
+ if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc {
+ sc, c = tag.ScriptID, Low
+ }
+ }
+ return Script{sc}, c
+}
+
+// Region returns the region for the language tag. If it was not explicitly given, it will
+// infer a most likely candidate from the context.
+// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
+func (t Tag) Region() (Region, Confidence) {
+ if r := t.region(); r != 0 {
+ return Region{r}, Exact
+ }
+ tt := t.tag()
+ if tt, err := tt.Maximize(); err == nil {
+ return Region{tt.RegionID}, Low // TODO: differentiate between high and low.
+ }
+ tt, _ = canonicalize(Deprecated|Macro, tt)
+ if tag, err := tt.Maximize(); err == nil {
+ return Region{tag.RegionID}, Low
+ }
+ return Region{_ZZ}, No // TODO: return world instead of undetermined?
+}
+
+// Variants returns the variants specified explicitly for this language tag.
+// or nil if no variant was specified.
+func (t Tag) Variants() []Variant {
+ if !compact.Tag(t).MayHaveVariants() {
+ return nil
+ }
+ v := []Variant{}
+ x, str := "", t.tag().Variants()
+ for str != "" {
+ x, str = nextToken(str)
+ v = append(v, Variant{x})
+ }
+ return v
+}
+
+// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
+// specific language are substituted with fields from the parent language.
+// The parent for a language may change for newer versions of CLDR.
+//
+// Parent returns a tag for a less specific language that is mutually
+// intelligible or Und if there is no such language. This may not be the same as
+// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW"
+// is "zh-Hant", and the parent of "zh-Hant" is "und".
+func (t Tag) Parent() Tag {
+ return Tag(compact.Tag(t).Parent())
+}
+
+// returns token t and the rest of the string.
+func nextToken(s string) (t, tail string) {
+ p := strings.Index(s[1:], "-")
+ if p == -1 {
+ return s[1:], ""
+ }
+ p++
+ return s[1:p], s[p:]
+}
+
+// Extension is a single BCP 47 extension.
+type Extension struct {
+ s string
+}
+
+// String returns the string representation of the extension, including the
+// type tag.
+func (e Extension) String() string {
+ return e.s
+}
+
+// ParseExtension parses s as an extension and returns it on success.
+func ParseExtension(s string) (e Extension, err error) {
+ ext, err := language.ParseExtension(s)
+ return Extension{ext}, err
+}
+
+// Type returns the one-byte extension type of e. It returns 0 for the zero
+// exception.
+func (e Extension) Type() byte {
+ if e.s == "" {
+ return 0
+ }
+ return e.s[0]
+}
+
+// Tokens returns the list of tokens of e.
+func (e Extension) Tokens() []string {
+ return strings.Split(e.s, "-")
+}
+
+// Extension returns the extension of type x for tag t. It will return
+// false for ok if t does not have the requested extension. The returned
+// extension will be invalid in this case.
+func (t Tag) Extension(x byte) (ext Extension, ok bool) {
+ if !compact.Tag(t).MayHaveExtensions() {
+ return Extension{}, false
+ }
+ e, ok := t.tag().Extension(x)
+ return Extension{e}, ok
+}
+
+// Extensions returns all extensions of t.
+func (t Tag) Extensions() []Extension {
+ if !compact.Tag(t).MayHaveExtensions() {
+ return nil
+ }
+ e := []Extension{}
+ for _, ext := range t.tag().Extensions() {
+ e = append(e, Extension{ext})
+ }
+ return e
+}
+
+// TypeForKey returns the type associated with the given key, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// TypeForKey will traverse the inheritance chain to get the correct value.
+func (t Tag) TypeForKey(key string) string {
+ if !compact.Tag(t).MayHaveExtensions() {
+ if key != "rg" && key != "va" {
+ return ""
+ }
+ }
+ return t.tag().TypeForKey(key)
+}
+
+// SetTypeForKey returns a new Tag with the key set to type, where key and type
+// are of the allowed values defined for the Unicode locale extension ('u') in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// An empty value removes an existing pair with the same key.
+func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
+ tt, err := t.tag().SetTypeForKey(key, value)
+ return makeTag(tt), err
+}
+
+// NumCompactTags is the number of compact tags. The maximum tag is
+// NumCompactTags-1.
+const NumCompactTags = compact.NumCompactTags
+
+// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags
+// for which data exists in the text repository.The index will change over time
+// and should not be stored in persistent storage. If t does not match a compact
+// index, exact will be false and the compact index will be returned for the
+// first match after repeatedly taking the Parent of t.
+func CompactIndex(t Tag) (index int, exact bool) {
+ id, exact := compact.LanguageID(compact.Tag(t))
+ return int(id), exact
+}
+
+var root = language.Tag{}
+
+// Base is an ISO 639 language code, used for encoding the base language
+// of a language tag.
+type Base struct {
+ langID language.Language
+}
+
+// ParseBase parses a 2- or 3-letter ISO 639 code.
+// It returns a ValueError if s is a well-formed but unknown language identifier
+// or another error if another error occurred.
+func ParseBase(s string) (Base, error) {
+ l, err := language.ParseBase(s)
+ return Base{l}, err
+}
+
+// String returns the BCP 47 representation of the base language.
+func (b Base) String() string {
+ return b.langID.String()
+}
+
+// ISO3 returns the ISO 639-3 language code.
+func (b Base) ISO3() string {
+ return b.langID.ISO3()
+}
+
+// IsPrivateUse reports whether this language code is reserved for private use.
+func (b Base) IsPrivateUse() bool {
+ return b.langID.IsPrivateUse()
+}
+
+// Script is a 4-letter ISO 15924 code for representing scripts.
+// It is idiomatically represented in title case.
+type Script struct {
+ scriptID language.Script
+}
+
+// ParseScript parses a 4-letter ISO 15924 code.
+// It returns a ValueError if s is a well-formed but unknown script identifier
+// or another error if another error occurred.
+func ParseScript(s string) (Script, error) {
+ sc, err := language.ParseScript(s)
+ return Script{sc}, err
+}
+
+// String returns the script code in title case.
+// It returns "Zzzz" for an unspecified script.
+func (s Script) String() string {
+ return s.scriptID.String()
+}
+
+// IsPrivateUse reports whether this script code is reserved for private use.
+func (s Script) IsPrivateUse() bool {
+ return s.scriptID.IsPrivateUse()
+}
+
+// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions.
+type Region struct {
+ regionID language.Region
+}
+
+// EncodeM49 returns the Region for the given UN M.49 code.
+// It returns an error if r is not a valid code.
+func EncodeM49(r int) (Region, error) {
+ rid, err := language.EncodeM49(r)
+ return Region{rid}, err
+}
+
+// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code.
+// It returns a ValueError if s is a well-formed but unknown region identifier
+// or another error if another error occurred.
+func ParseRegion(s string) (Region, error) {
+ r, err := language.ParseRegion(s)
+ return Region{r}, err
+}
+
+// String returns the BCP 47 representation for the region.
+// It returns "ZZ" for an unspecified region.
+func (r Region) String() string {
+ return r.regionID.String()
+}
+
+// ISO3 returns the 3-letter ISO code of r.
+// Note that not all regions have a 3-letter ISO code.
+// In such cases this method returns "ZZZ".
+func (r Region) ISO3() string {
+ return r.regionID.ISO3()
+}
+
+// M49 returns the UN M.49 encoding of r, or 0 if this encoding
+// is not defined for r.
+func (r Region) M49() int {
+ return r.regionID.M49()
+}
+
+// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
+// may include private-use tags that are assigned by CLDR and used in this
+// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
+func (r Region) IsPrivateUse() bool {
+ return r.regionID.IsPrivateUse()
+}
+
+// IsCountry returns whether this region is a country or autonomous area. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsCountry() bool {
+ return r.regionID.IsCountry()
+}
+
+// IsGroup returns whether this region defines a collection of regions. This
+// includes non-standard definitions from CLDR.
+func (r Region) IsGroup() bool {
+ return r.regionID.IsGroup()
+}
+
+// Contains returns whether Region c is contained by Region r. It returns true
+// if c == r.
+func (r Region) Contains(c Region) bool {
+ return r.regionID.Contains(c.regionID)
+}
+
+// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
+// In all other cases it returns either the region itself or an error.
+//
+// This method may return an error for a region for which there exists a
+// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The
+// region will already be canonicalized it was obtained from a Tag that was
+// obtained using any of the default methods.
+func (r Region) TLD() (Region, error) {
+ tld, err := r.regionID.TLD()
+ return Region{tld}, err
+}
+
+// Canonicalize returns the region or a possible replacement if the region is
+// deprecated. It will not return a replacement for deprecated regions that
+// are split into multiple regions.
+func (r Region) Canonicalize() Region {
+ return Region{r.regionID.Canonicalize()}
+}
+
+// Variant represents a registered variant of a language as defined by BCP 47.
+type Variant struct {
+ variant string
+}
+
+// ParseVariant parses and returns a Variant. An error is returned if s is not
+// a valid variant.
+func ParseVariant(s string) (Variant, error) {
+ v, err := language.ParseVariant(s)
+ return Variant{v.String()}, err
+}
+
+// String returns the string representation of the variant.
+func (v Variant) String() string {
+ return v.variant
+}
diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go
new file mode 100644
index 00000000..f7349213
--- /dev/null
+++ b/vendor/golang.org/x/text/language/match.go
@@ -0,0 +1,735 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "errors"
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// A MatchOption configures a Matcher.
+type MatchOption func(*matcher)
+
+// PreferSameScript will, in the absence of a match, result in the first
+// preferred tag with the same script as a supported tag to match this supported
+// tag. The default is currently true, but this may change in the future.
+func PreferSameScript(preferSame bool) MatchOption {
+ return func(m *matcher) { m.preferSameScript = preferSame }
+}
+
+// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface.
+// There doesn't seem to be too much need for multiple types.
+// Making it a concrete type allows MatchStrings to be a method, which will
+// improve its discoverability.
+
+// MatchStrings parses and matches the given strings until one of them matches
+// the language in the Matcher. A string may be an Accept-Language header as
+// handled by ParseAcceptLanguage. The default language is returned if no
+// other language matched.
+func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) {
+ for _, accept := range lang {
+ desired, _, err := ParseAcceptLanguage(accept)
+ if err != nil {
+ continue
+ }
+ if tag, index, conf := m.Match(desired...); conf != No {
+ return tag, index
+ }
+ }
+ tag, index, _ = m.Match()
+ return
+}
+
+// Matcher is the interface that wraps the Match method.
+//
+// Match returns the best match for any of the given tags, along with
+// a unique index associated with the returned tag and a confidence
+// score.
+type Matcher interface {
+ Match(t ...Tag) (tag Tag, index int, c Confidence)
+}
+
+// Comprehends reports the confidence score for a speaker of a given language
+// to being able to comprehend the written form of an alternative language.
+func Comprehends(speaker, alternative Tag) Confidence {
+ _, _, c := NewMatcher([]Tag{alternative}).Match(speaker)
+ return c
+}
+
+// NewMatcher returns a Matcher that matches an ordered list of preferred tags
+// against a list of supported tags based on written intelligibility, closeness
+// of dialect, equivalence of subtags and various other rules. It is initialized
+// with the list of supported tags. The first element is used as the default
+// value in case no match is found.
+//
+// Its Match method matches the first of the given Tags to reach a certain
+// confidence threshold. The tags passed to Match should therefore be specified
+// in order of preference. Extensions are ignored for matching.
+//
+// The index returned by the Match method corresponds to the index of the
+// matched tag in t, but is augmented with the Unicode extension ('u')of the
+// corresponding preferred tag. This allows user locale options to be passed
+// transparently.
+func NewMatcher(t []Tag, options ...MatchOption) Matcher {
+ return newMatcher(t, options)
+}
+
+func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) {
+ var tt language.Tag
+ match, w, c := m.getBest(want...)
+ if match != nil {
+ tt, index = match.tag, match.index
+ } else {
+ // TODO: this should be an option
+ tt = m.default_.tag
+ if m.preferSameScript {
+ outer:
+ for _, w := range want {
+ script, _ := w.Script()
+ if script.scriptID == 0 {
+ // Don't do anything if there is no script, such as with
+ // private subtags.
+ continue
+ }
+ for i, h := range m.supported {
+ if script.scriptID == h.maxScript {
+ tt, index = h.tag, i
+ break outer
+ }
+ }
+ }
+ }
+ // TODO: select first language tag based on script.
+ }
+ if w.RegionID != tt.RegionID && w.RegionID != 0 {
+ if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) {
+ tt.RegionID = w.RegionID
+ tt.RemakeString()
+ } else if r := w.RegionID.String(); len(r) == 2 {
+ // TODO: also filter macro and deprecated.
+ tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz")
+ }
+ }
+ // Copy options from the user-provided tag into the result tag. This is hard
+ // to do after the fact, so we do it here.
+ // TODO: add in alternative variants to -u-va-.
+ // TODO: add preferred region to -u-rg-.
+ if e := w.Extensions(); len(e) > 0 {
+ b := language.Builder{}
+ b.SetTag(tt)
+ for _, e := range e {
+ b.AddExt(e)
+ }
+ tt = b.Make()
+ }
+ return makeTag(tt), index, c
+}
+
+// ErrMissingLikelyTagsData indicates no information was available
+// to compute likely values of missing tags.
+var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
+
+// func (t *Tag) setTagsFrom(id Tag) {
+// t.LangID = id.LangID
+// t.ScriptID = id.ScriptID
+// t.RegionID = id.RegionID
+// }
+
+// Tag Matching
+// CLDR defines an algorithm for finding the best match between two sets of language
+// tags. The basic algorithm defines how to score a possible match and then find
+// the match with the best score
+// (see https://www.unicode.org/reports/tr35/#LanguageMatching).
+// Using scoring has several disadvantages. The scoring obfuscates the importance of
+// the various factors considered, making the algorithm harder to understand. Using
+// scoring also requires the full score to be computed for each pair of tags.
+//
+// We will use a different algorithm which aims to have the following properties:
+// - clarity on the precedence of the various selection factors, and
+// - improved performance by allowing early termination of a comparison.
+//
+// Matching algorithm (overview)
+// Input:
+// - supported: a set of supported tags
+// - default: the default tag to return in case there is no match
+// - desired: list of desired tags, ordered by preference, starting with
+// the most-preferred.
+//
+// Algorithm:
+// 1) Set the best match to the lowest confidence level
+// 2) For each tag in "desired":
+// a) For each tag in "supported":
+// 1) compute the match between the two tags.
+// 2) if the match is better than the previous best match, replace it
+// with the new match. (see next section)
+// b) if the current best match is Exact and pin is true the result will be
+// frozen to the language found thusfar, although better matches may
+// still be found for the same language.
+// 3) If the best match so far is below a certain threshold, return "default".
+//
+// Ranking:
+// We use two phases to determine whether one pair of tags are a better match
+// than another pair of tags. First, we determine a rough confidence level. If the
+// levels are different, the one with the highest confidence wins.
+// Second, if the rough confidence levels are identical, we use a set of tie-breaker
+// rules.
+//
+// The confidence level of matching a pair of tags is determined by finding the
+// lowest confidence level of any matches of the corresponding subtags (the
+// result is deemed as good as its weakest link).
+// We define the following levels:
+// Exact - An exact match of a subtag, before adding likely subtags.
+// MaxExact - An exact match of a subtag, after adding likely subtags.
+// [See Note 2].
+// High - High level of mutual intelligibility between different subtag
+// variants.
+// Low - Low level of mutual intelligibility between different subtag
+// variants.
+// No - No mutual intelligibility.
+//
+// The following levels can occur for each type of subtag:
+// Base: Exact, MaxExact, High, Low, No
+// Script: Exact, MaxExact [see Note 3], Low, No
+// Region: Exact, MaxExact, High
+// Variant: Exact, High
+// Private: Exact, No
+//
+// Any result with a confidence level of Low or higher is deemed a possible match.
+// Once a desired tag matches any of the supported tags with a level of MaxExact
+// or higher, the next desired tag is not considered (see Step 2.b).
+// Note that CLDR provides languageMatching data that defines close equivalence
+// classes for base languages, scripts and regions.
+//
+// Tie-breaking
+// If we get the same confidence level for two matches, we apply a sequence of
+// tie-breaking rules. The first that succeeds defines the result. The rules are
+// applied in the following order.
+// 1) Original language was defined and was identical.
+// 2) Original region was defined and was identical.
+// 3) Distance between two maximized regions was the smallest.
+// 4) Original script was defined and was identical.
+// 5) Distance from want tag to have tag using the parent relation [see Note 5.]
+// If there is still no winner after these rules are applied, the first match
+// found wins.
+//
+// Notes:
+// [2] In practice, as matching of Exact is done in a separate phase from
+// matching the other levels, we reuse the Exact level to mean MaxExact in
+// the second phase. As a consequence, we only need the levels defined by
+// the Confidence type. The MaxExact confidence level is mapped to High in
+// the public API.
+// [3] We do not differentiate between maximized script values that were derived
+// from suppressScript versus most likely tag data. We determined that in
+// ranking the two, one ranks just after the other. Moreover, the two cannot
+// occur concurrently. As a consequence, they are identical for practical
+// purposes.
+// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign
+// the MaxExact level to allow iw vs he to still be a closer match than
+// en-AU vs en-US, for example.
+// [5] In CLDR a locale inherits fields that are unspecified for this locale
+// from its parent. Therefore, if a locale is a parent of another locale,
+// it is a strong measure for closeness, especially when no other tie
+// breaker rule applies. One could also argue it is inconsistent, for
+// example, when pt-AO matches pt (which CLDR equates with pt-BR), even
+// though its parent is pt-PT according to the inheritance rules.
+//
+// Implementation Details:
+// There are several performance considerations worth pointing out. Most notably,
+// we preprocess as much as possible (within reason) at the time of creation of a
+// matcher. This includes:
+// - creating a per-language map, which includes data for the raw base language
+// and its canonicalized variant (if applicable),
+// - expanding entries for the equivalence classes defined in CLDR's
+// languageMatch data.
+// The per-language map ensures that typically only a very small number of tags
+// need to be considered. The pre-expansion of canonicalized subtags and
+// equivalence classes reduces the amount of map lookups that need to be done at
+// runtime.
+
+// matcher keeps a set of supported language tags, indexed by language.
+type matcher struct {
+ default_ *haveTag
+ supported []*haveTag
+ index map[language.Language]*matchHeader
+ passSettings bool
+ preferSameScript bool
+}
+
+// matchHeader has the lists of tags for exact matches and matches based on
+// maximized and canonicalized tags for a given language.
+type matchHeader struct {
+ haveTags []*haveTag
+ original bool
+}
+
+// haveTag holds a supported Tag and its maximized script and region. The maximized
+// or canonicalized language is not stored as it is not needed during matching.
+type haveTag struct {
+ tag language.Tag
+
+ // index of this tag in the original list of supported tags.
+ index int
+
+ // conf is the maximum confidence that can result from matching this haveTag.
+ // When conf < Exact this means it was inserted after applying a CLDR equivalence rule.
+ conf Confidence
+
+ // Maximized region and script.
+ maxRegion language.Region
+ maxScript language.Script
+
+ // altScript may be checked as an alternative match to maxScript. If altScript
+ // matches, the confidence level for this match is Low. Theoretically there
+ // could be multiple alternative scripts. This does not occur in practice.
+ altScript language.Script
+
+ // nextMax is the index of the next haveTag with the same maximized tags.
+ nextMax uint16
+}
+
+func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) {
+ max := tag
+ if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 {
+ max, _ = canonicalize(All, max)
+ max, _ = max.Maximize()
+ max.RemakeString()
+ }
+ return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID
+}
+
+// altScript returns an alternative script that may match the given script with
+// a low confidence. At the moment, the langMatch data allows for at most one
+// script to map to another and we rely on this to keep the code simple.
+func altScript(l language.Language, s language.Script) language.Script {
+ for _, alt := range matchScript {
+ // TODO: also match cases where language is not the same.
+ if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) &&
+ language.Script(alt.haveScript) == s {
+ return language.Script(alt.wantScript)
+ }
+ }
+ return 0
+}
+
+// addIfNew adds a haveTag to the list of tags only if it is a unique tag.
+// Tags that have the same maximized values are linked by index.
+func (h *matchHeader) addIfNew(n haveTag, exact bool) {
+ h.original = h.original || exact
+ // Don't add new exact matches.
+ for _, v := range h.haveTags {
+ if equalsRest(v.tag, n.tag) {
+ return
+ }
+ }
+ // Allow duplicate maximized tags, but create a linked list to allow quickly
+ // comparing the equivalents and bail out.
+ for i, v := range h.haveTags {
+ if v.maxScript == n.maxScript &&
+ v.maxRegion == n.maxRegion &&
+ v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() {
+ for h.haveTags[i].nextMax != 0 {
+ i = int(h.haveTags[i].nextMax)
+ }
+ h.haveTags[i].nextMax = uint16(len(h.haveTags))
+ break
+ }
+ }
+ h.haveTags = append(h.haveTags, &n)
+}
+
+// header returns the matchHeader for the given language. It creates one if
+// it doesn't already exist.
+func (m *matcher) header(l language.Language) *matchHeader {
+ if h := m.index[l]; h != nil {
+ return h
+ }
+ h := &matchHeader{}
+ m.index[l] = h
+ return h
+}
+
+func toConf(d uint8) Confidence {
+ if d <= 10 {
+ return High
+ }
+ if d < 30 {
+ return Low
+ }
+ return No
+}
+
+// newMatcher builds an index for the given supported tags and returns it as
+// a matcher. It also expands the index by considering various equivalence classes
+// for a given tag.
+func newMatcher(supported []Tag, options []MatchOption) *matcher {
+ m := &matcher{
+ index: make(map[language.Language]*matchHeader),
+ preferSameScript: true,
+ }
+ for _, o := range options {
+ o(m)
+ }
+ if len(supported) == 0 {
+ m.default_ = &haveTag{}
+ return m
+ }
+ // Add supported languages to the index. Add exact matches first to give
+ // them precedence.
+ for i, tag := range supported {
+ tt := tag.tag()
+ pair, _ := makeHaveTag(tt, i)
+ m.header(tt.LangID).addIfNew(pair, true)
+ m.supported = append(m.supported, &pair)
+ }
+ m.default_ = m.header(supported[0].lang()).haveTags[0]
+ // Keep these in two different loops to support the case that two equivalent
+ // languages are distinguished, such as iw and he.
+ for i, tag := range supported {
+ tt := tag.tag()
+ pair, max := makeHaveTag(tt, i)
+ if max != tt.LangID {
+ m.header(max).addIfNew(pair, true)
+ }
+ }
+
+ // update is used to add indexes in the map for equivalent languages.
+ // update will only add entries to original indexes, thus not computing any
+ // transitive relations.
+ update := func(want, have uint16, conf Confidence) {
+ if hh := m.index[language.Language(have)]; hh != nil {
+ if !hh.original {
+ return
+ }
+ hw := m.header(language.Language(want))
+ for _, ht := range hh.haveTags {
+ v := *ht
+ if conf < v.conf {
+ v.conf = conf
+ }
+ v.nextMax = 0 // this value needs to be recomputed
+ if v.altScript != 0 {
+ v.altScript = altScript(language.Language(want), v.maxScript)
+ }
+ hw.addIfNew(v, conf == Exact && hh.original)
+ }
+ }
+ }
+
+ // Add entries for languages with mutual intelligibility as defined by CLDR's
+ // languageMatch data.
+ for _, ml := range matchLang {
+ update(ml.want, ml.have, toConf(ml.distance))
+ if !ml.oneway {
+ update(ml.have, ml.want, toConf(ml.distance))
+ }
+ }
+
+ // Add entries for possible canonicalizations. This is an optimization to
+ // ensure that only one map lookup needs to be done at runtime per desired tag.
+ // First we match deprecated equivalents. If they are perfect equivalents
+ // (their canonicalization simply substitutes a different language code, but
+ // nothing else), the match confidence is Exact, otherwise it is High.
+ for i, lm := range language.AliasMap {
+ // If deprecated codes match and there is no fiddling with the script or
+ // or region, we consider it an exact match.
+ conf := Exact
+ if language.AliasTypes[i] != language.Macro {
+ if !isExactEquivalent(language.Language(lm.From)) {
+ conf = High
+ }
+ update(lm.To, lm.From, conf)
+ }
+ update(lm.From, lm.To, conf)
+ }
+ return m
+}
+
+// getBest gets the best matching tag in m for any of the given tags, taking into
+// account the order of preference of the given tags.
+func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) {
+ best := bestMatch{}
+ for i, ww := range want {
+ w := ww.tag()
+ var max language.Tag
+ // Check for exact match first.
+ h := m.index[w.LangID]
+ if w.LangID != 0 {
+ if h == nil {
+ continue
+ }
+ // Base language is defined.
+ max, _ = canonicalize(Legacy|Deprecated|Macro, w)
+ // A region that is added through canonicalization is stronger than
+ // a maximized region: set it in the original (e.g. mo -> ro-MD).
+ if w.RegionID != max.RegionID {
+ w.RegionID = max.RegionID
+ }
+ // TODO: should we do the same for scripts?
+ // See test case: en, sr, nl ; sh ; sr
+ max, _ = max.Maximize()
+ } else {
+ // Base language is not defined.
+ if h != nil {
+ for i := range h.haveTags {
+ have := h.haveTags[i]
+ if equalsRest(have.tag, w) {
+ return have, w, Exact
+ }
+ }
+ }
+ if w.ScriptID == 0 && w.RegionID == 0 {
+ // We skip all tags matching und for approximate matching, including
+ // private tags.
+ continue
+ }
+ max, _ = w.Maximize()
+ if h = m.index[max.LangID]; h == nil {
+ continue
+ }
+ }
+ pin := true
+ for _, t := range want[i+1:] {
+ if w.LangID == t.lang() {
+ pin = false
+ break
+ }
+ }
+ // Check for match based on maximized tag.
+ for i := range h.haveTags {
+ have := h.haveTags[i]
+ best.update(have, w, max.ScriptID, max.RegionID, pin)
+ if best.conf == Exact {
+ for have.nextMax != 0 {
+ have = h.haveTags[have.nextMax]
+ best.update(have, w, max.ScriptID, max.RegionID, pin)
+ }
+ return best.have, best.want, best.conf
+ }
+ }
+ }
+ if best.conf <= No {
+ if len(want) != 0 {
+ return nil, want[0].tag(), No
+ }
+ return nil, language.Tag{}, No
+ }
+ return best.have, best.want, best.conf
+}
+
+// bestMatch accumulates the best match so far.
+type bestMatch struct {
+ have *haveTag
+ want language.Tag
+ conf Confidence
+ pinnedRegion language.Region
+ pinLanguage bool
+ sameRegionGroup bool
+ // Cached results from applying tie-breaking rules.
+ origLang bool
+ origReg bool
+ paradigmReg bool
+ regGroupDist uint8
+ origScript bool
+}
+
+// update updates the existing best match if the new pair is considered to be a
+// better match. To determine if the given pair is a better match, it first
+// computes the rough confidence level. If this surpasses the current match, it
+// will replace it and update the tie-breaker rule cache. If there is a tie, it
+// proceeds with applying a series of tie-breaker rules. If there is no
+// conclusive winner after applying the tie-breaker rules, it leaves the current
+// match as the preferred match.
+//
+// If pin is true and have and tag are a strong match, it will henceforth only
+// consider matches for this language. This corresponds to the nothing that most
+// users have a strong preference for the first defined language. A user can
+// still prefer a second language over a dialect of the preferred language by
+// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should
+// be false.
+func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) {
+ // Bail if the maximum attainable confidence is below that of the current best match.
+ c := have.conf
+ if c < m.conf {
+ return
+ }
+ // Don't change the language once we already have found an exact match.
+ if m.pinLanguage && tag.LangID != m.want.LangID {
+ return
+ }
+ // Pin the region group if we are comparing tags for the same language.
+ if tag.LangID == m.want.LangID && m.sameRegionGroup {
+ _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID)
+ if !sameGroup {
+ return
+ }
+ }
+ if c == Exact && have.maxScript == maxScript {
+ // If there is another language and then another entry of this language,
+ // don't pin anything, otherwise pin the language.
+ m.pinLanguage = pin
+ }
+ if equalsRest(have.tag, tag) {
+ } else if have.maxScript != maxScript {
+ // There is usually very little comprehension between different scripts.
+ // In a few cases there may still be Low comprehension. This possibility
+ // is pre-computed and stored in have.altScript.
+ if Low < m.conf || have.altScript != maxScript {
+ return
+ }
+ c = Low
+ } else if have.maxRegion != maxRegion {
+ if High < c {
+ // There is usually a small difference between languages across regions.
+ c = High
+ }
+ }
+
+ // We store the results of the computations of the tie-breaker rules along
+ // with the best match. There is no need to do the checks once we determine
+ // we have a winner, but we do still need to do the tie-breaker computations.
+ // We use "beaten" to keep track if we still need to do the checks.
+ beaten := false // true if the new pair defeats the current one.
+ if c != m.conf {
+ if c < m.conf {
+ return
+ }
+ beaten = true
+ }
+
+ // Tie-breaker rules:
+ // We prefer if the pre-maximized language was specified and identical.
+ origLang := have.tag.LangID == tag.LangID && tag.LangID != 0
+ if !beaten && m.origLang != origLang {
+ if m.origLang {
+ return
+ }
+ beaten = true
+ }
+
+ // We prefer if the pre-maximized region was specified and identical.
+ origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0
+ if !beaten && m.origReg != origReg {
+ if m.origReg {
+ return
+ }
+ beaten = true
+ }
+
+ regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID)
+ if !beaten && m.regGroupDist != regGroupDist {
+ if regGroupDist > m.regGroupDist {
+ return
+ }
+ beaten = true
+ }
+
+ paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion)
+ if !beaten && m.paradigmReg != paradigmReg {
+ if !paradigmReg {
+ return
+ }
+ beaten = true
+ }
+
+ // Next we prefer if the pre-maximized script was specified and identical.
+ origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0
+ if !beaten && m.origScript != origScript {
+ if m.origScript {
+ return
+ }
+ beaten = true
+ }
+
+ // Update m to the newly found best match.
+ if beaten {
+ m.have = have
+ m.want = tag
+ m.conf = c
+ m.pinnedRegion = maxRegion
+ m.sameRegionGroup = sameGroup
+ m.origLang = origLang
+ m.origReg = origReg
+ m.paradigmReg = paradigmReg
+ m.origScript = origScript
+ m.regGroupDist = regGroupDist
+ }
+}
+
+func isParadigmLocale(lang language.Language, r language.Region) bool {
+ for _, e := range paradigmLocales {
+ if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) {
+ return true
+ }
+ }
+ return false
+}
+
+// regionGroupDist computes the distance between two regions based on their
+// CLDR grouping.
+func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) {
+ const defaultDistance = 4
+
+ aGroup := uint(regionToGroups[a]) << 1
+ bGroup := uint(regionToGroups[b]) << 1
+ for _, ri := range matchRegion {
+ if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) {
+ group := uint(1 << (ri.group &^ 0x80))
+ if 0x80&ri.group == 0 {
+ if aGroup&bGroup&group != 0 { // Both regions are in the group.
+ return ri.distance, ri.distance == defaultDistance
+ }
+ } else {
+ if (aGroup|bGroup)&group == 0 { // Both regions are not in the group.
+ return ri.distance, ri.distance == defaultDistance
+ }
+ }
+ }
+ }
+ return defaultDistance, true
+}
+
+// equalsRest compares everything except the language.
+func equalsRest(a, b language.Tag) bool {
+ // TODO: don't include extensions in this comparison. To do this efficiently,
+ // though, we should handle private tags separately.
+ return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags()
+}
+
+// isExactEquivalent returns true if canonicalizing the language will not alter
+// the script or region of a tag.
+func isExactEquivalent(l language.Language) bool {
+ for _, o := range notEquivalent {
+ if o == l {
+ return false
+ }
+ }
+ return true
+}
+
+var notEquivalent []language.Language
+
+func init() {
+ // Create a list of all languages for which canonicalization may alter the
+ // script or region.
+ for _, lm := range language.AliasMap {
+ tag := language.Tag{LangID: language.Language(lm.From)}
+ if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 {
+ notEquivalent = append(notEquivalent, language.Language(lm.From))
+ }
+ }
+ // Maximize undefined regions of paradigm locales.
+ for i, v := range paradigmLocales {
+ t := language.Tag{LangID: language.Language(v[0])}
+ max, _ := t.Maximize()
+ if v[1] == 0 {
+ paradigmLocales[i][1] = uint16(max.RegionID)
+ }
+ if v[2] == 0 {
+ paradigmLocales[i][2] = uint16(max.RegionID)
+ }
+ }
+}
diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go
new file mode 100644
index 00000000..11acfd88
--- /dev/null
+++ b/vendor/golang.org/x/text/language/parse.go
@@ -0,0 +1,228 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import (
+ "errors"
+ "strconv"
+ "strings"
+
+ "golang.org/x/text/internal/language"
+)
+
+// ValueError is returned by any of the parsing functions when the
+// input is well-formed but the respective subtag is not recognized
+// as a valid value.
+type ValueError interface {
+ error
+
+ // Subtag returns the subtag for which the error occurred.
+ Subtag() string
+}
+
+// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
+// failed it returns an error and any part of the tag that could be parsed.
+// If parsing succeeded but an unknown value was found, it returns
+// ValueError. The Tag returned in this case is just stripped of the unknown
+// value. All other values are preserved. It accepts tags in the BCP 47 format
+// and extensions to this standard defined in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// The resulting tag is canonicalized using the default canonicalization type.
+func Parse(s string) (t Tag, err error) {
+ return Default.Parse(s)
+}
+
+// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
+// failed it returns an error and any part of the tag that could be parsed.
+// If parsing succeeded but an unknown value was found, it returns
+// ValueError. The Tag returned in this case is just stripped of the unknown
+// value. All other values are preserved. It accepts tags in the BCP 47 format
+// and extensions to this standard defined in
+// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
+// The resulting tag is canonicalized using the canonicalization type c.
+func (c CanonType) Parse(s string) (t Tag, err error) {
+ tt, err := language.Parse(s)
+ if err != nil {
+ return makeTag(tt), err
+ }
+ tt, changed := canonicalize(c, tt)
+ if changed {
+ tt.RemakeString()
+ }
+ return makeTag(tt), err
+}
+
+// Compose creates a Tag from individual parts, which may be of type Tag, Base,
+// Script, Region, Variant, []Variant, Extension, []Extension or error. If a
+// Base, Script or Region or slice of type Variant or Extension is passed more
+// than once, the latter will overwrite the former. Variants and Extensions are
+// accumulated, but if two extensions of the same type are passed, the latter
+// will replace the former. For -u extensions, though, the key-type pairs are
+// added, where later values overwrite older ones. A Tag overwrites all former
+// values and typically only makes sense as the first argument. The resulting
+// tag is returned after canonicalizing using the Default CanonType. If one or
+// more errors are encountered, one of the errors is returned.
+func Compose(part ...interface{}) (t Tag, err error) {
+ return Default.Compose(part...)
+}
+
+// Compose creates a Tag from individual parts, which may be of type Tag, Base,
+// Script, Region, Variant, []Variant, Extension, []Extension or error. If a
+// Base, Script or Region or slice of type Variant or Extension is passed more
+// than once, the latter will overwrite the former. Variants and Extensions are
+// accumulated, but if two extensions of the same type are passed, the latter
+// will replace the former. For -u extensions, though, the key-type pairs are
+// added, where later values overwrite older ones. A Tag overwrites all former
+// values and typically only makes sense as the first argument. The resulting
+// tag is returned after canonicalizing using CanonType c. If one or more errors
+// are encountered, one of the errors is returned.
+func (c CanonType) Compose(part ...interface{}) (t Tag, err error) {
+ var b language.Builder
+ if err = update(&b, part...); err != nil {
+ return und, err
+ }
+ b.Tag, _ = canonicalize(c, b.Tag)
+ return makeTag(b.Make()), err
+}
+
+var errInvalidArgument = errors.New("invalid Extension or Variant")
+
+func update(b *language.Builder, part ...interface{}) (err error) {
+ for _, x := range part {
+ switch v := x.(type) {
+ case Tag:
+ b.SetTag(v.tag())
+ case Base:
+ b.Tag.LangID = v.langID
+ case Script:
+ b.Tag.ScriptID = v.scriptID
+ case Region:
+ b.Tag.RegionID = v.regionID
+ case Variant:
+ if v.variant == "" {
+ err = errInvalidArgument
+ break
+ }
+ b.AddVariant(v.variant)
+ case Extension:
+ if v.s == "" {
+ err = errInvalidArgument
+ break
+ }
+ b.SetExt(v.s)
+ case []Variant:
+ b.ClearVariants()
+ for _, v := range v {
+ b.AddVariant(v.variant)
+ }
+ case []Extension:
+ b.ClearExtensions()
+ for _, e := range v {
+ b.SetExt(e.s)
+ }
+ // TODO: support parsing of raw strings based on morphology or just extensions?
+ case error:
+ if v != nil {
+ err = v
+ }
+ }
+ }
+ return
+}
+
+var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight")
+
+// ParseAcceptLanguage parses the contents of an Accept-Language header as
+// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and
+// a list of corresponding quality weights. It is more permissive than RFC 2616
+// and may return non-nil slices even if the input is not valid.
+// The Tags will be sorted by highest weight first and then by first occurrence.
+// Tags with a weight of zero will be dropped. An error will be returned if the
+// input could not be parsed.
+func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) {
+ var entry string
+ for s != "" {
+ if entry, s = split(s, ','); entry == "" {
+ continue
+ }
+
+ entry, weight := split(entry, ';')
+
+ // Scan the language.
+ t, err := Parse(entry)
+ if err != nil {
+ id, ok := acceptFallback[entry]
+ if !ok {
+ return nil, nil, err
+ }
+ t = makeTag(language.Tag{LangID: id})
+ }
+
+ // Scan the optional weight.
+ w := 1.0
+ if weight != "" {
+ weight = consume(weight, 'q')
+ weight = consume(weight, '=')
+ // consume returns the empty string when a token could not be
+ // consumed, resulting in an error for ParseFloat.
+ if w, err = strconv.ParseFloat(weight, 32); err != nil {
+ return nil, nil, errInvalidWeight
+ }
+ // Drop tags with a quality weight of 0.
+ if w <= 0 {
+ continue
+ }
+ }
+
+ tag = append(tag, t)
+ q = append(q, float32(w))
+ }
+ sortStable(&tagSort{tag, q})
+ return tag, q, nil
+}
+
+// consume removes a leading token c from s and returns the result or the empty
+// string if there is no such token.
+func consume(s string, c byte) string {
+ if s == "" || s[0] != c {
+ return ""
+ }
+ return strings.TrimSpace(s[1:])
+}
+
+func split(s string, c byte) (head, tail string) {
+ if i := strings.IndexByte(s, c); i >= 0 {
+ return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:])
+ }
+ return strings.TrimSpace(s), ""
+}
+
+// Add hack mapping to deal with a small number of cases that occur
+// in Accept-Language (with reasonable frequency).
+var acceptFallback = map[string]language.Language{
+ "english": _en,
+ "deutsch": _de,
+ "italian": _it,
+ "french": _fr,
+ "*": _mul, // defined in the spec to match all languages.
+}
+
+type tagSort struct {
+ tag []Tag
+ q []float32
+}
+
+func (s *tagSort) Len() int {
+ return len(s.q)
+}
+
+func (s *tagSort) Less(i, j int) bool {
+ return s.q[i] > s.q[j]
+}
+
+func (s *tagSort) Swap(i, j int) {
+ s.tag[i], s.tag[j] = s.tag[j], s.tag[i]
+ s.q[i], s.q[j] = s.q[j], s.q[i]
+}
diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go
new file mode 100644
index 00000000..e2280771
--- /dev/null
+++ b/vendor/golang.org/x/text/language/tables.go
@@ -0,0 +1,298 @@
+// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
+
+package language
+
+// CLDRVersion is the CLDR version from which the tables in this package are derived.
+const CLDRVersion = "32"
+
+const (
+ _de = 269
+ _en = 313
+ _fr = 350
+ _it = 505
+ _mo = 784
+ _no = 879
+ _nb = 839
+ _pt = 960
+ _sh = 1031
+ _mul = 806
+ _und = 0
+)
+const (
+ _001 = 1
+ _419 = 31
+ _BR = 65
+ _CA = 73
+ _ES = 110
+ _GB = 123
+ _MD = 188
+ _PT = 238
+ _UK = 306
+ _US = 309
+ _ZZ = 357
+ _XA = 323
+ _XC = 325
+ _XK = 333
+)
+const (
+ _Latn = 87
+ _Hani = 54
+ _Hans = 56
+ _Hant = 57
+ _Qaaa = 139
+ _Qaai = 147
+ _Qabx = 188
+ _Zinh = 236
+ _Zyyy = 241
+ _Zzzz = 242
+)
+
+var regionToGroups = []uint8{ // 357 elements
+ // Entry 0 - 3F
+ 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04,
+ 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00,
+ 0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00,
+ 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04,
+ // Entry 40 - 7F
+ 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00,
+ 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08,
+ 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00,
+ // Entry 80 - BF
+ 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00,
+ 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04,
+ 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00,
+ 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00,
+ // Entry C0 - FF
+ 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01,
+ 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00,
+ 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ // Entry 100 - 13F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00,
+ 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00,
+ 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00,
+ // Entry 140 - 17F
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
+ 0x00, 0x00, 0x00, 0x00, 0x00,
+} // Size: 381 bytes
+
+var paradigmLocales = [][3]uint16{ // 3 elements
+ 0: [3]uint16{0x139, 0x0, 0x7b},
+ 1: [3]uint16{0x13e, 0x0, 0x1f},
+ 2: [3]uint16{0x3c0, 0x41, 0xee},
+} // Size: 42 bytes
+
+type mutualIntelligibility struct {
+ want uint16
+ have uint16
+ distance uint8
+ oneway bool
+}
+type scriptIntelligibility struct {
+ wantLang uint16
+ haveLang uint16
+ wantScript uint8
+ haveScript uint8
+ distance uint8
+}
+type regionIntelligibility struct {
+ lang uint16
+ script uint8
+ group uint8
+ distance uint8
+}
+
+// matchLang holds pairs of langIDs of base languages that are typically
+// mutually intelligible. Each pair is associated with a confidence and
+// whether the intelligibility goes one or both ways.
+var matchLang = []mutualIntelligibility{ // 113 elements
+ 0: {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false},
+ 1: {want: 0x407, have: 0xb7, distance: 0x4, oneway: false},
+ 2: {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false},
+ 3: {want: 0x407, have: 0x432, distance: 0x4, oneway: false},
+ 4: {want: 0x43a, have: 0x1, distance: 0x4, oneway: false},
+ 5: {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true},
+ 6: {want: 0x295, have: 0x10d, distance: 0x4, oneway: true},
+ 7: {want: 0x101, have: 0x36f, distance: 0x8, oneway: false},
+ 8: {want: 0x101, have: 0x347, distance: 0x8, oneway: false},
+ 9: {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true},
+ 10: {want: 0xd, have: 0x139, distance: 0xa, oneway: true},
+ 11: {want: 0x16, have: 0x367, distance: 0xa, oneway: true},
+ 12: {want: 0x21, have: 0x139, distance: 0xa, oneway: true},
+ 13: {want: 0x56, have: 0x13e, distance: 0xa, oneway: true},
+ 14: {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true},
+ 15: {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true},
+ 16: {want: 0x75, have: 0x139, distance: 0xa, oneway: true},
+ 17: {want: 0x82, have: 0x1be, distance: 0xa, oneway: true},
+ 18: {want: 0xa5, have: 0x139, distance: 0xa, oneway: true},
+ 19: {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true},
+ 20: {want: 0xdd, have: 0x153, distance: 0xa, oneway: true},
+ 21: {want: 0xe5, have: 0x139, distance: 0xa, oneway: true},
+ 22: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true},
+ 23: {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true},
+ 24: {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true},
+ 25: {want: 0x100, have: 0x139, distance: 0xa, oneway: true},
+ 26: {want: 0x130, have: 0x139, distance: 0xa, oneway: true},
+ 27: {want: 0x13c, have: 0x139, distance: 0xa, oneway: true},
+ 28: {want: 0x140, have: 0x151, distance: 0xa, oneway: true},
+ 29: {want: 0x145, have: 0x13e, distance: 0xa, oneway: true},
+ 30: {want: 0x158, have: 0x101, distance: 0xa, oneway: true},
+ 31: {want: 0x16d, have: 0x367, distance: 0xa, oneway: true},
+ 32: {want: 0x16e, have: 0x139, distance: 0xa, oneway: true},
+ 33: {want: 0x16f, have: 0x139, distance: 0xa, oneway: true},
+ 34: {want: 0x17e, have: 0x139, distance: 0xa, oneway: true},
+ 35: {want: 0x190, have: 0x13e, distance: 0xa, oneway: true},
+ 36: {want: 0x194, have: 0x13e, distance: 0xa, oneway: true},
+ 37: {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true},
+ 38: {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true},
+ 39: {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true},
+ 40: {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true},
+ 41: {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true},
+ 42: {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true},
+ 43: {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true},
+ 44: {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true},
+ 45: {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true},
+ 46: {want: 0x210, have: 0x139, distance: 0xa, oneway: true},
+ 47: {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true},
+ 48: {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true},
+ 49: {want: 0x24a, have: 0x139, distance: 0xa, oneway: true},
+ 50: {want: 0x251, have: 0x139, distance: 0xa, oneway: true},
+ 51: {want: 0x265, have: 0x139, distance: 0xa, oneway: true},
+ 52: {want: 0x274, have: 0x48a, distance: 0xa, oneway: true},
+ 53: {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true},
+ 54: {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true},
+ 55: {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true},
+ 56: {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true},
+ 57: {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true},
+ 58: {want: 0x2be, have: 0x139, distance: 0xa, oneway: true},
+ 59: {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true},
+ 60: {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true},
+ 61: {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true},
+ 62: {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true},
+ 63: {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true},
+ 64: {want: 0x304, have: 0x139, distance: 0xa, oneway: true},
+ 65: {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true},
+ 66: {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true},
+ 67: {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true},
+ 68: {want: 0x320, have: 0x139, distance: 0xa, oneway: true},
+ 69: {want: 0x331, have: 0x139, distance: 0xa, oneway: true},
+ 70: {want: 0x351, have: 0x139, distance: 0xa, oneway: true},
+ 71: {want: 0x36a, have: 0x347, distance: 0xa, oneway: false},
+ 72: {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true},
+ 73: {want: 0x37a, have: 0x139, distance: 0xa, oneway: true},
+ 74: {want: 0x387, have: 0x139, distance: 0xa, oneway: true},
+ 75: {want: 0x389, have: 0x139, distance: 0xa, oneway: true},
+ 76: {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true},
+ 77: {want: 0x390, have: 0x139, distance: 0xa, oneway: true},
+ 78: {want: 0x395, have: 0x139, distance: 0xa, oneway: true},
+ 79: {want: 0x39d, have: 0x139, distance: 0xa, oneway: true},
+ 80: {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true},
+ 81: {want: 0x3be, have: 0x139, distance: 0xa, oneway: true},
+ 82: {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true},
+ 83: {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true},
+ 84: {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true},
+ 85: {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true},
+ 86: {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true},
+ 87: {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true},
+ 88: {want: 0x40c, have: 0x139, distance: 0xa, oneway: true},
+ 89: {want: 0x423, have: 0x139, distance: 0xa, oneway: true},
+ 90: {want: 0x429, have: 0x139, distance: 0xa, oneway: true},
+ 91: {want: 0x431, have: 0x139, distance: 0xa, oneway: true},
+ 92: {want: 0x43b, have: 0x139, distance: 0xa, oneway: true},
+ 93: {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true},
+ 94: {want: 0x445, have: 0x139, distance: 0xa, oneway: true},
+ 95: {want: 0x450, have: 0x139, distance: 0xa, oneway: true},
+ 96: {want: 0x461, have: 0x139, distance: 0xa, oneway: true},
+ 97: {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true},
+ 98: {want: 0x46f, have: 0x139, distance: 0xa, oneway: true},
+ 99: {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true},
+ 100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true},
+ 101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true},
+ 102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true},
+ 103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true},
+ 104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true},
+ 105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true},
+ 106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true},
+ 107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true},
+ 108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true},
+ 109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true},
+ 110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true},
+ 111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true},
+ 112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true},
+} // Size: 702 bytes
+
+// matchScript holds pairs of scriptIDs where readers of one script
+// can typically also read the other. Each is associated with a confidence.
+var matchScript = []scriptIntelligibility{ // 26 elements
+ 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x57, haveScript: 0x1f, distance: 0x5},
+ 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x1f, haveScript: 0x57, distance: 0x5},
+ 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa},
+ 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x57, distance: 0xa},
+ 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x1f, distance: 0xa},
+ 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2b, haveScript: 0x57, distance: 0xa},
+ 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4b, haveScript: 0x57, distance: 0xa},
+ 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x57, distance: 0xa},
+ 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x54, haveScript: 0x57, distance: 0xa},
+ 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6b, haveScript: 0x57, distance: 0xa},
+ 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x72, haveScript: 0x57, distance: 0xa},
+ 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x21, haveScript: 0x57, distance: 0xa},
+ 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x7d, haveScript: 0x57, distance: 0xa},
+ 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x33, haveScript: 0x57, distance: 0xa},
+ 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa},
+ 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa},
+ 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xca, haveScript: 0x57, distance: 0xa},
+ 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xd7, haveScript: 0x57, distance: 0xa},
+ 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xda, haveScript: 0x57, distance: 0xa},
+ 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x29, haveScript: 0x57, distance: 0xa},
+ 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa},
+ 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa},
+ 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa},
+ 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3b, haveScript: 0x57, distance: 0xa},
+ 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x38, haveScript: 0x39, distance: 0xf},
+ 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x39, haveScript: 0x38, distance: 0x13},
+} // Size: 232 bytes
+
+var matchRegion = []regionIntelligibility{ // 15 elements
+ 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4},
+ 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4},
+ 2: {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4},
+ 3: {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4},
+ 4: {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4},
+ 5: {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4},
+ 6: {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4},
+ 7: {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4},
+ 8: {lang: 0x529, script: 0x39, group: 0x2, distance: 0x4},
+ 9: {lang: 0x529, script: 0x39, group: 0x82, distance: 0x4},
+ 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5},
+ 11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5},
+ 12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5},
+ 13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5},
+ 14: {lang: 0x529, script: 0x39, group: 0x80, distance: 0x5},
+} // Size: 114 bytes
+
+// Total table size 1471 bytes (1KiB); checksum: 4CB1CD46
diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go
new file mode 100644
index 00000000..42ea7926
--- /dev/null
+++ b/vendor/golang.org/x/text/language/tags.go
@@ -0,0 +1,145 @@
+// Copyright 2013 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package language
+
+import "golang.org/x/text/internal/language/compact"
+
+// TODO: Various sets of commonly use tags and regions.
+
+// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
+// It simplifies safe initialization of Tag values.
+func MustParse(s string) Tag {
+ t, err := Parse(s)
+ if err != nil {
+ panic(err)
+ }
+ return t
+}
+
+// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
+// It simplifies safe initialization of Tag values.
+func (c CanonType) MustParse(s string) Tag {
+ t, err := c.Parse(s)
+ if err != nil {
+ panic(err)
+ }
+ return t
+}
+
+// MustParseBase is like ParseBase, but panics if the given base cannot be parsed.
+// It simplifies safe initialization of Base values.
+func MustParseBase(s string) Base {
+ b, err := ParseBase(s)
+ if err != nil {
+ panic(err)
+ }
+ return b
+}
+
+// MustParseScript is like ParseScript, but panics if the given script cannot be
+// parsed. It simplifies safe initialization of Script values.
+func MustParseScript(s string) Script {
+ scr, err := ParseScript(s)
+ if err != nil {
+ panic(err)
+ }
+ return scr
+}
+
+// MustParseRegion is like ParseRegion, but panics if the given region cannot be
+// parsed. It simplifies safe initialization of Region values.
+func MustParseRegion(s string) Region {
+ r, err := ParseRegion(s)
+ if err != nil {
+ panic(err)
+ }
+ return r
+}
+
+var (
+ und = Tag{}
+
+ Und Tag = Tag{}
+
+ Afrikaans Tag = Tag(compact.Afrikaans)
+ Amharic Tag = Tag(compact.Amharic)
+ Arabic Tag = Tag(compact.Arabic)
+ ModernStandardArabic Tag = Tag(compact.ModernStandardArabic)
+ Azerbaijani Tag = Tag(compact.Azerbaijani)
+ Bulgarian Tag = Tag(compact.Bulgarian)
+ Bengali Tag = Tag(compact.Bengali)
+ Catalan Tag = Tag(compact.Catalan)
+ Czech Tag = Tag(compact.Czech)
+ Danish Tag = Tag(compact.Danish)
+ German Tag = Tag(compact.German)
+ Greek Tag = Tag(compact.Greek)
+ English Tag = Tag(compact.English)
+ AmericanEnglish Tag = Tag(compact.AmericanEnglish)
+ BritishEnglish Tag = Tag(compact.BritishEnglish)
+ Spanish Tag = Tag(compact.Spanish)
+ EuropeanSpanish Tag = Tag(compact.EuropeanSpanish)
+ LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish)
+ Estonian Tag = Tag(compact.Estonian)
+ Persian Tag = Tag(compact.Persian)
+ Finnish Tag = Tag(compact.Finnish)
+ Filipino Tag = Tag(compact.Filipino)
+ French Tag = Tag(compact.French)
+ CanadianFrench Tag = Tag(compact.CanadianFrench)
+ Gujarati Tag = Tag(compact.Gujarati)
+ Hebrew Tag = Tag(compact.Hebrew)
+ Hindi Tag = Tag(compact.Hindi)
+ Croatian Tag = Tag(compact.Croatian)
+ Hungarian Tag = Tag(compact.Hungarian)
+ Armenian Tag = Tag(compact.Armenian)
+ Indonesian Tag = Tag(compact.Indonesian)
+ Icelandic Tag = Tag(compact.Icelandic)
+ Italian Tag = Tag(compact.Italian)
+ Japanese Tag = Tag(compact.Japanese)
+ Georgian Tag = Tag(compact.Georgian)
+ Kazakh Tag = Tag(compact.Kazakh)
+ Khmer Tag = Tag(compact.Khmer)
+ Kannada Tag = Tag(compact.Kannada)
+ Korean Tag = Tag(compact.Korean)
+ Kirghiz Tag = Tag(compact.Kirghiz)
+ Lao Tag = Tag(compact.Lao)
+ Lithuanian Tag = Tag(compact.Lithuanian)
+ Latvian Tag = Tag(compact.Latvian)
+ Macedonian Tag = Tag(compact.Macedonian)
+ Malayalam Tag = Tag(compact.Malayalam)
+ Mongolian Tag = Tag(compact.Mongolian)
+ Marathi Tag = Tag(compact.Marathi)
+ Malay Tag = Tag(compact.Malay)
+ Burmese Tag = Tag(compact.Burmese)
+ Nepali Tag = Tag(compact.Nepali)
+ Dutch Tag = Tag(compact.Dutch)
+ Norwegian Tag = Tag(compact.Norwegian)
+ Punjabi Tag = Tag(compact.Punjabi)
+ Polish Tag = Tag(compact.Polish)
+ Portuguese Tag = Tag(compact.Portuguese)
+ BrazilianPortuguese Tag = Tag(compact.BrazilianPortuguese)
+ EuropeanPortuguese Tag = Tag(compact.EuropeanPortuguese)
+ Romanian Tag = Tag(compact.Romanian)
+ Russian Tag = Tag(compact.Russian)
+ Sinhala Tag = Tag(compact.Sinhala)
+ Slovak Tag = Tag(compact.Slovak)
+ Slovenian Tag = Tag(compact.Slovenian)
+ Albanian Tag = Tag(compact.Albanian)
+ Serbian Tag = Tag(compact.Serbian)
+ SerbianLatin Tag = Tag(compact.SerbianLatin)
+ Swedish Tag = Tag(compact.Swedish)
+ Swahili Tag = Tag(compact.Swahili)
+ Tamil Tag = Tag(compact.Tamil)
+ Telugu Tag = Tag(compact.Telugu)
+ Thai Tag = Tag(compact.Thai)
+ Turkish Tag = Tag(compact.Turkish)
+ Ukrainian Tag = Tag(compact.Ukrainian)
+ Urdu Tag = Tag(compact.Urdu)
+ Uzbek Tag = Tag(compact.Uzbek)
+ Vietnamese Tag = Tag(compact.Vietnamese)
+ Chinese Tag = Tag(compact.Chinese)
+ SimplifiedChinese Tag = Tag(compact.SimplifiedChinese)
+ TraditionalChinese Tag = Tag(compact.TraditionalChinese)
+ Zulu Tag = Tag(compact.Zulu)
+)
generated by cgit v1.2.3 (git 2.39.1) at 2024-11-23 03:00:43 +0000