Use mod vendor for vendored directory (backwards compatible)

38 files changed, 0 insertions, 11744 deletions

diff --git a/vendor/golang.org/x/text/internal/format/LICENSE b/vendor/golang.org/x/text/internal/format/LICENSE
deleted file mode 100644
index 6a66aea5..00000000
--- a/vendor/golang.org/x/text/internal/format/LICENSE
+++ /dev/null
@@ -1,27 +0,0 @@
-Copyright (c) 2009 The Go Authors. All rights reserved.
-
-Redistribution and use in source and binary forms, with or without
-modification, are permitted provided that the following conditions are
-met:
-
-   * Redistributions of source code must retain the above copyright
-notice, this list of conditions and the following disclaimer.
-   * Redistributions in binary form must reproduce the above
-copyright notice, this list of conditions and the following disclaimer
-in the documentation and/or other materials provided with the
-distribution.
-   * Neither the name of Google Inc. nor the names of its
-contributors may be used to endorse or promote products derived from
-this software without specific prior written permission.
-
-THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS
-"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT
-LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR
-A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT
-OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL,
-SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT
-LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE,
-DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY
-THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT
-(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE
-OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
diff --git a/vendor/golang.org/x/text/internal/format/format.go b/vendor/golang.org/x/text/internal/format/format.go
deleted file mode 100644
index ee1c57a3..00000000
--- a/vendor/golang.org/x/text/internal/format/format.go
+++ /dev/null
@@ -1,41 +0,0 @@
-// Copyright 2015 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package format contains types for defining language-specific formatting of
-// values.
-//
-// This package is internal now, but will eventually be exposed after the API
-// settles.
-package format // import "golang.org/x/text/internal/format"
-
-import (
-	"fmt"
-
-	"golang.org/x/text/language"
-)
-
-// State represents the printer state passed to custom formatters. It provides
-// access to the fmt.State interface and the sentence and language-related
-// context.
-type State interface {
-	fmt.State
-
-	// Language reports the requested language in which to render a message.
-	Language() language.Tag
-
-	// TODO: consider this and removing rune from the Format method in the
-	// Formatter interface.
-	//
-	// Verb returns the format variant to render, analogous to the types used
-	// in fmt. Use 'v' for the default or only variant.
-	// Verb() rune
-
-	// TODO: more info:
-	// - sentence context such as linguistic features passed by the translator.
-}
-
-// Formatter is analogous to fmt.Formatter.
-type Formatter interface {
-	Format(state State, verb rune)
-}
diff --git a/vendor/golang.org/x/text/internal/format/parser.go b/vendor/golang.org/x/text/internal/format/parser.go
deleted file mode 100644
index 855aed71..00000000
--- a/vendor/golang.org/x/text/internal/format/parser.go
+++ /dev/null
@@ -1,358 +0,0 @@
-// Copyright 2017 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package format
-
-import (
-	"reflect"
-	"unicode/utf8"
-)
-
-// A Parser parses a format string. The result from the parse are set in the
-// struct fields.
-type Parser struct {
-	Verb rune
-
-	WidthPresent bool
-	PrecPresent  bool
-	Minus        bool
-	Plus         bool
-	Sharp        bool
-	Space        bool
-	Zero         bool
-
-	// For the formats %+v %#v, we set the plusV/sharpV flags
-	// and clear the plus/sharp flags since %+v and %#v are in effect
-	// different, flagless formats set at the top level.
-	PlusV  bool
-	SharpV bool
-
-	HasIndex bool
-
-	Width int
-	Prec  int // precision
-
-	// retain arguments across calls.
-	Args []interface{}
-	// retain current argument number across calls
-	ArgNum int
-
-	// reordered records whether the format string used argument reordering.
-	Reordered bool
-	// goodArgNum records whether the most recent reordering directive was valid.
-	goodArgNum bool
-
-	// position info
-	format   string
-	startPos int
-	endPos   int
-	Status   Status
-}
-
-// Reset initializes a parser to scan format strings for the given args.
-func (p *Parser) Reset(args []interface{}) {
-	p.Args = args
-	p.ArgNum = 0
-	p.startPos = 0
-	p.Reordered = false
-}
-
-// Text returns the part of the format string that was parsed by the last call
-// to Scan. It returns the original substitution clause if the current scan
-// parsed a substitution.
-func (p *Parser) Text() string { return p.format[p.startPos:p.endPos] }
-
-// SetFormat sets a new format string to parse. It does not reset the argument
-// count.
-func (p *Parser) SetFormat(format string) {
-	p.format = format
-	p.startPos = 0
-	p.endPos = 0
-}
-
-// Status indicates the result type of a call to Scan.
-type Status int
-
-const (
-	StatusText Status = iota
-	StatusSubstitution
-	StatusBadWidthSubstitution
-	StatusBadPrecSubstitution
-	StatusNoVerb
-	StatusBadArgNum
-	StatusMissingArg
-)
-
-// ClearFlags reset the parser to default behavior.
-func (p *Parser) ClearFlags() {
-	p.WidthPresent = false
-	p.PrecPresent = false
-	p.Minus = false
-	p.Plus = false
-	p.Sharp = false
-	p.Space = false
-	p.Zero = false
-
-	p.PlusV = false
-	p.SharpV = false
-
-	p.HasIndex = false
-}
-
-// Scan scans the next part of the format string and sets the status to
-// indicate whether it scanned a string literal, substitution or error.
-func (p *Parser) Scan() bool {
-	p.Status = StatusText
-	format := p.format
-	end := len(format)
-	if p.endPos >= end {
-		return false
-	}
-	afterIndex := false // previous item in format was an index like [3].
-
-	p.startPos = p.endPos
-	p.goodArgNum = true
-	i := p.startPos
-	for i < end && format[i] != '%' {
-		i++
-	}
-	if i > p.startPos {
-		p.endPos = i
-		return true
-	}
-	// Process one verb
-	i++
-
-	p.Status = StatusSubstitution
-
-	// Do we have flags?
-	p.ClearFlags()
-
-simpleFormat:
-	for ; i < end; i++ {
-		c := p.format[i]
-		switch c {
-		case '#':
-			p.Sharp = true
-		case '0':
-			p.Zero = !p.Minus // Only allow zero padding to the left.
-		case '+':
-			p.Plus = true
-		case '-':
-			p.Minus = true
-			p.Zero = false // Do not pad with zeros to the right.
-		case ' ':
-			p.Space = true
-		default:
-			// Fast path for common case of ascii lower case simple verbs
-			// without precision or width or argument indices.
-			if 'a' <= c && c <= 'z' && p.ArgNum < len(p.Args) {
-				if c == 'v' {
-					// Go syntax
-					p.SharpV = p.Sharp
-					p.Sharp = false
-					// Struct-field syntax
-					p.PlusV = p.Plus
-					p.Plus = false
-				}
-				p.Verb = rune(c)
-				p.ArgNum++
-				p.endPos = i + 1
-				return true
-			}
-			// Format is more complex than simple flags and a verb or is malformed.
-			break simpleFormat
-		}
-	}
-
-	// Do we have an explicit argument index?
-	i, afterIndex = p.updateArgNumber(format, i)
-
-	// Do we have width?
-	if i < end && format[i] == '*' {
-		i++
-		p.Width, p.WidthPresent = p.intFromArg()
-
-		if !p.WidthPresent {
-			p.Status = StatusBadWidthSubstitution
-		}
-
-		// We have a negative width, so take its value and ensure
-		// that the minus flag is set
-		if p.Width < 0 {
-			p.Width = -p.Width
-			p.Minus = true
-			p.Zero = false // Do not pad with zeros to the right.
-		}
-		afterIndex = false
-	} else {
-		p.Width, p.WidthPresent, i = parsenum(format, i, end)
-		if afterIndex && p.WidthPresent { // "%[3]2d"
-			p.goodArgNum = false
-		}
-	}
-
-	// Do we have precision?
-	if i+1 < end && format[i] == '.' {
-		i++
-		if afterIndex { // "%[3].2d"
-			p.goodArgNum = false
-		}
-		i, afterIndex = p.updateArgNumber(format, i)
-		if i < end && format[i] == '*' {
-			i++
-			p.Prec, p.PrecPresent = p.intFromArg()
-			// Negative precision arguments don't make sense
-			if p.Prec < 0 {
-				p.Prec = 0
-				p.PrecPresent = false
-			}
-			if !p.PrecPresent {
-				p.Status = StatusBadPrecSubstitution
-			}
-			afterIndex = false
-		} else {
-			p.Prec, p.PrecPresent, i = parsenum(format, i, end)
-			if !p.PrecPresent {
-				p.Prec = 0
-				p.PrecPresent = true
-			}
-		}
-	}
-
-	if !afterIndex {
-		i, afterIndex = p.updateArgNumber(format, i)
-	}
-	p.HasIndex = afterIndex
-
-	if i >= end {
-		p.endPos = i
-		p.Status = StatusNoVerb
-		return true
-	}
-
-	verb, w := utf8.DecodeRuneInString(format[i:])
-	p.endPos = i + w
-	p.Verb = verb
-
-	switch {
-	case verb == '%': // Percent does not absorb operands and ignores f.wid and f.prec.
-		p.startPos = p.endPos - 1
-		p.Status = StatusText
-	case !p.goodArgNum:
-		p.Status = StatusBadArgNum
-	case p.ArgNum >= len(p.Args): // No argument left over to print for the current verb.
-		p.Status = StatusMissingArg
-		p.ArgNum++
-	case verb == 'v':
-		// Go syntax
-		p.SharpV = p.Sharp
-		p.Sharp = false
-		// Struct-field syntax
-		p.PlusV = p.Plus
-		p.Plus = false
-		fallthrough
-	default:
-		p.ArgNum++
-	}
-	return true
-}
-
-// intFromArg gets the ArgNumth element of Args. On return, isInt reports
-// whether the argument has integer type.
-func (p *Parser) intFromArg() (num int, isInt bool) {
-	if p.ArgNum < len(p.Args) {
-		arg := p.Args[p.ArgNum]
-		num, isInt = arg.(int) // Almost always OK.
-		if !isInt {
-			// Work harder.
-			switch v := reflect.ValueOf(arg); v.Kind() {
-			case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64:
-				n := v.Int()
-				if int64(int(n)) == n {
-					num = int(n)
-					isInt = true
-				}
-			case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr:
-				n := v.Uint()
-				if int64(n) >= 0 && uint64(int(n)) == n {
-					num = int(n)
-					isInt = true
-				}
-			default:
-				// Already 0, false.
-			}
-		}
-		p.ArgNum++
-		if tooLarge(num) {
-			num = 0
-			isInt = false
-		}
-	}
-	return
-}
-
-// parseArgNumber returns the value of the bracketed number, minus 1
-// (explicit argument numbers are one-indexed but we want zero-indexed).
-// The opening bracket is known to be present at format[0].
-// The returned values are the index, the number of bytes to consume
-// up to the closing paren, if present, and whether the number parsed
-// ok. The bytes to consume will be 1 if no closing paren is present.
-func parseArgNumber(format string) (index int, wid int, ok bool) {
-	// There must be at least 3 bytes: [n].
-	if len(format) < 3 {
-		return 0, 1, false
-	}
-
-	// Find closing bracket.
-	for i := 1; i < len(format); i++ {
-		if format[i] == ']' {
-			width, ok, newi := parsenum(format, 1, i)
-			if !ok || newi != i {
-				return 0, i + 1, false
-			}
-			return width - 1, i + 1, true // arg numbers are one-indexed and skip paren.
-		}
-	}
-	return 0, 1, false
-}
-
-// updateArgNumber returns the next argument to evaluate, which is either the value of the passed-in
-// argNum or the value of the bracketed integer that begins format[i:]. It also returns
-// the new value of i, that is, the index of the next byte of the format to process.
-func (p *Parser) updateArgNumber(format string, i int) (newi int, found bool) {
-	if len(format) <= i || format[i] != '[' {
-		return i, false
-	}
-	p.Reordered = true
-	index, wid, ok := parseArgNumber(format[i:])
-	if ok && 0 <= index && index < len(p.Args) {
-		p.ArgNum = index
-		return i + wid, true
-	}
-	p.goodArgNum = false
-	return i + wid, ok
-}
-
-// tooLarge reports whether the magnitude of the integer is
-// too large to be used as a formatting width or precision.
-func tooLarge(x int) bool {
-	const max int = 1e6
-	return x > max || x < -max
-}
-
-// parsenum converts ASCII to integer.  num is 0 (and isnum is false) if no number present.
-func parsenum(s string, start, end int) (num int, isnum bool, newi int) {
-	if start >= end {
-		return 0, false, end
-	}
-	for newi = start; newi < end && '0' <= s[newi] && s[newi] <= '9'; newi++ {
-		if tooLarge(num) {
-			return 0, false, end // Overflow; crazy long number most likely.
-		}
-		num = num*10 + int(s[newi]-'0')
-		isnum = true
-	}
-	return
-}
diff --git a/vendor/golang.org/x/text/internal/gen/LICENSE b/vendor/golang.org/x/text/internal/gen/LICENSE
deleted file mode 100644
index 6a66aea5..00000000
--- a/vendor/golang.org/x/text/internal/gen/LICENSE
+++ /dev/null
@@ -1,27 +0,0 @@
-Copyright (c) 2009 The Go Authors. All rights reserved.
-
-Redistribution and use in source and binary forms, with or without
-modification, are permitted provided that the following conditions are
-met:
-
-   * Redistributions of source code must retain the above copyright
-notice, this list of conditions and the following disclaimer.
-   * Redistributions in binary form must reproduce the above
-copyright notice, this list of conditions and the following disclaimer
-in the documentation and/or other materials provided with the
-distribution.
-   * Neither the name of Google Inc. nor the names of its
-contributors may be used to endorse or promote products derived from
-this software without specific prior written permission.
-
-THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS
-"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT
-LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR
-A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT
-OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL,
-SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT
-LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE,
-DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY
-THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT
-(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE
-OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
diff --git a/vendor/golang.org/x/text/internal/gen/bitfield/bitfield.go b/vendor/golang.org/x/text/internal/gen/bitfield/bitfield.go
deleted file mode 100644
index a8d0a48d..00000000
--- a/vendor/golang.org/x/text/internal/gen/bitfield/bitfield.go
+++ /dev/null
@@ -1,226 +0,0 @@
-// Copyright 2018 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package bitfield converts annotated structs into integer values.
-//
-// Any field that is marked with a bitfield tag is compacted. The tag value has
-// two parts. The part before the comma determines the method name for a
-// generated type. If left blank the name of the field is used.
-// The part after the comma determines the number of bits to use for the
-// representation.
-package bitfield
-
-import (
-	"bytes"
-	"fmt"
-	"io"
-	"reflect"
-	"strconv"
-	"strings"
-)
-
-// Config determines settings for packing and generation. If a Config is used,
-// the same Config should be used for packing and generation.
-type Config struct {
-	// NumBits fixes the maximum allowed bits for the integer representation.
-	// If NumBits is not 8, 16, 32, or 64, the actual underlying integer size
-	// will be the next largest available.
-	NumBits uint
-
-	// If Package is set, code generation will write a package clause.
-	Package string
-
-	// TypeName is the name for the generated type. By default it is the name
-	// of the type of the value passed to Gen.
-	TypeName string
-}
-
-var nullConfig = &Config{}
-
-// Pack packs annotated bit ranges of struct x in an integer.
-//
-// Only fields that have a "bitfield" tag are compacted.
-func Pack(x interface{}, c *Config) (packed uint64, err error) {
-	packed, _, err = pack(x, c)
-	return
-}
-
-func pack(x interface{}, c *Config) (packed uint64, nBit uint, err error) {
-	if c == nil {
-		c = nullConfig
-	}
-	nBits := c.NumBits
-	v := reflect.ValueOf(x)
-	v = reflect.Indirect(v)
-	t := v.Type()
-	pos := 64 - nBits
-	if nBits == 0 {
-		pos = 0
-	}
-	for i := 0; i < v.NumField(); i++ {
-		v := v.Field(i)
-		field := t.Field(i)
-		f, err := parseField(field)
-
-		if err != nil {
-			return 0, 0, err
-		}
-		if f.nBits == 0 {
-			continue
-		}
-		value := uint64(0)
-		switch v.Kind() {
-		case reflect.Bool:
-			if v.Bool() {
-				value = 1
-			}
-		case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64:
-			value = v.Uint()
-		case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64:
-			x := v.Int()
-			if x < 0 {
-				return 0, 0, fmt.Errorf("bitfield: negative value for field %q not allowed", field.Name)
-			}
-			value = uint64(x)
-		}
-		if value > (1<<f.nBits)-1 {
-			return 0, 0, fmt.Errorf("bitfield: value %#x of field %q does not fit in %d bits", value, field.Name, f.nBits)
-		}
-		shift := 64 - pos - f.nBits
-		if pos += f.nBits; pos > 64 {
-			return 0, 0, fmt.Errorf("bitfield: no more bits left for field %q", field.Name)
-		}
-		packed |= value << shift
-	}
-	if nBits == 0 {
-		nBits = posToBits(pos)
-		packed >>= (64 - nBits)
-	}
-	return packed, nBits, nil
-}
-
-type field struct {
-	name  string
-	value uint64
-	nBits uint
-}
-
-// parseField parses a tag of the form [<name>][:<nBits>][,<pos>[..<end>]]
-func parseField(field reflect.StructField) (f field, err error) {
-	s, ok := field.Tag.Lookup("bitfield")
-	if !ok {
-		return f, nil
-	}
-	switch field.Type.Kind() {
-	case reflect.Bool:
-	case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64:
-	case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64:
-	default:
-		return f, fmt.Errorf("bitfield: field %q is not an integer or bool type", field.Name)
-	}
-	bits := s
-	f.name = ""
-
-	if i := strings.IndexByte(s, ','); i >= 0 {
-		bits = s[:i]
-		f.name = s[i+1:]
-	}
-	if bits != "" {
-		nBits, err := strconv.ParseUint(bits, 10, 8)
-		if err != nil {
-			return f, fmt.Errorf("bitfield: invalid bit size for field %q: %v", field.Name, err)
-		}
-		f.nBits = uint(nBits)
-	}
-	if f.nBits == 0 {
-		if field.Type.Kind() == reflect.Bool {
-			f.nBits = 1
-		} else {
-			f.nBits = uint(field.Type.Bits())
-		}
-	}
-	if f.name == "" {
-		f.name = field.Name
-	}
-	return f, err
-}
-
-func posToBits(pos uint) (bits uint) {
-	switch {
-	case pos <= 8:
-		bits = 8
-	case pos <= 16:
-		bits = 16
-	case pos <= 32:
-		bits = 32
-	case pos <= 64:
-		bits = 64
-	default:
-		panic("unreachable")
-	}
-	return bits
-}
-
-// Gen generates code for unpacking integers created with Pack.
-func Gen(w io.Writer, x interface{}, c *Config) error {
-	if c == nil {
-		c = nullConfig
-	}
-	_, nBits, err := pack(x, c)
-	if err != nil {
-		return err
-	}
-
-	t := reflect.TypeOf(x)
-	if t.Kind() == reflect.Ptr {
-		t = t.Elem()
-	}
-	if c.TypeName == "" {
-		c.TypeName = t.Name()
-	}
-	firstChar := []rune(c.TypeName)[0]
-
-	buf := &bytes.Buffer{}
-
-	print := func(w io.Writer, format string, args ...interface{}) {
-		if _, e := fmt.Fprintf(w, format+"\n", args...); e != nil && err == nil {
-			err = fmt.Errorf("bitfield: write failed: %v", err)
-		}
-	}
-
-	pos := uint(0)
-	for i := 0; i < t.NumField(); i++ {
-		field := t.Field(i)
-		f, _ := parseField(field)
-		if f.nBits == 0 {
-			continue
-		}
-		shift := nBits - pos - f.nBits
-		pos += f.nBits
-
-		retType := field.Type.Name()
-		print(buf, "\nfunc (%c %s) %s() %s {", firstChar, c.TypeName, f.name, retType)
-		if field.Type.Kind() == reflect.Bool {
-			print(buf, "\tconst bit = 1 << %d", shift)
-			print(buf, "\treturn %c&bit == bit", firstChar)
-		} else {
-			print(buf, "\treturn %s((%c >> %d) & %#x)", retType, firstChar, shift, (1<<f.nBits)-1)
-		}
-		print(buf, "}")
-	}
-
-	if c.Package != "" {
-		print(w, "// Code generated by golang.org/x/text/internal/gen/bitfield. DO NOT EDIT.\n")
-		print(w, "package %s\n", c.Package)
-	}
-
-	bits := posToBits(pos)
-
-	print(w, "type %s uint%d", c.TypeName, bits)
-
-	if _, err := io.Copy(w, buf); err != nil {
-		return fmt.Errorf("bitfield: write failed: %v", err)
-	}
-	return nil
-}
diff --git a/vendor/golang.org/x/text/internal/gen/code.go b/vendor/golang.org/x/text/internal/gen/code.go
deleted file mode 100644
index 25aaa033..00000000
--- a/vendor/golang.org/x/text/internal/gen/code.go
+++ /dev/null
@@ -1,371 +0,0 @@
-// Copyright 2015 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package gen
-
-import (
-	"bytes"
-	"encoding/gob"
-	"fmt"
-	"hash"
-	"hash/fnv"
-	"io"
-	"log"
-	"os"
-	"reflect"
-	"strings"
-	"unicode"
-	"unicode/utf8"
-)
-
-// This file contains utilities for generating code.
-
-// TODO: other write methods like:
-// - slices, maps, types, etc.
-
-// CodeWriter is a utility for writing structured code. It computes the content
-// hash and size of written content. It ensures there are newlines between
-// written code blocks.
-type CodeWriter struct {
-	buf  bytes.Buffer
-	Size int
-	Hash hash.Hash32 // content hash
-	gob  *gob.Encoder
-	// For comments we skip the usual one-line separator if they are followed by
-	// a code block.
-	skipSep bool
-}
-
-func (w *CodeWriter) Write(p []byte) (n int, err error) {
-	return w.buf.Write(p)
-}
-
-// NewCodeWriter returns a new CodeWriter.
-func NewCodeWriter() *CodeWriter {
-	h := fnv.New32()
-	return &CodeWriter{Hash: h, gob: gob.NewEncoder(h)}
-}
-
-// WriteGoFile appends the buffer with the total size of all created structures
-// and writes it as a Go file to the the given file with the given package name.
-func (w *CodeWriter) WriteGoFile(filename, pkg string) {
-	f, err := os.Create(filename)
-	if err != nil {
-		log.Fatalf("Could not create file %s: %v", filename, err)
-	}
-	defer f.Close()
-	if _, err = w.WriteGo(f, pkg, ""); err != nil {
-		log.Fatalf("Error writing file %s: %v", filename, err)
-	}
-}
-
-// WriteVersionedGoFile appends the buffer with the total size of all created
-// structures and writes it as a Go file to the the given file with the given
-// package name and build tags for the current Unicode version,
-func (w *CodeWriter) WriteVersionedGoFile(filename, pkg string) {
-	tags := buildTags()
-	if tags != "" {
-		filename = insertVersion(filename, UnicodeVersion())
-	}
-	f, err := os.Create(filename)
-	if err != nil {
-		log.Fatalf("Could not create file %s: %v", filename, err)
-	}
-	defer f.Close()
-	if _, err = w.WriteGo(f, pkg, tags); err != nil {
-		log.Fatalf("Error writing file %s: %v", filename, err)
-	}
-}
-
-// WriteGo appends the buffer with the total size of all created structures and
-// writes it as a Go file to the the given writer with the given package name.
-func (w *CodeWriter) WriteGo(out io.Writer, pkg, tags string) (n int, err error) {
-	sz := w.Size
-	w.WriteComment("Total table size %d bytes (%dKiB); checksum: %X\n", sz, sz/1024, w.Hash.Sum32())
-	defer w.buf.Reset()
-	return WriteGo(out, pkg, tags, w.buf.Bytes())
-}
-
-func (w *CodeWriter) printf(f string, x ...interface{}) {
-	fmt.Fprintf(w, f, x...)
-}
-
-func (w *CodeWriter) insertSep() {
-	if w.skipSep {
-		w.skipSep = false
-		return
-	}
-	// Use at least two newlines to ensure a blank space between the previous
-	// block. WriteGoFile will remove extraneous newlines.
-	w.printf("\n\n")
-}
-
-// WriteComment writes a comment block. All line starts are prefixed with "//".
-// Initial empty lines are gobbled. The indentation for the first line is
-// stripped from consecutive lines.
-func (w *CodeWriter) WriteComment(comment string, args ...interface{}) {
-	s := fmt.Sprintf(comment, args...)
-	s = strings.Trim(s, "\n")
-
-	// Use at least two newlines to ensure a blank space between the previous
-	// block. WriteGoFile will remove extraneous newlines.
-	w.printf("\n\n// ")
-	w.skipSep = true
-
-	// strip first indent level.
-	sep := "\n"
-	for ; len(s) > 0 && (s[0] == '\t' || s[0] == ' '); s = s[1:] {
-		sep += s[:1]
-	}
-
-	strings.NewReplacer(sep, "\n// ", "\n", "\n// ").WriteString(w, s)
-
-	w.printf("\n")
-}
-
-func (w *CodeWriter) writeSizeInfo(size int) {
-	w.printf("// Size: %d bytes\n", size)
-}
-
-// WriteConst writes a constant of the given name and value.
-func (w *CodeWriter) WriteConst(name string, x interface{}) {
-	w.insertSep()
-	v := reflect.ValueOf(x)
-
-	switch v.Type().Kind() {
-	case reflect.String:
-		w.printf("const %s %s = ", name, typeName(x))
-		w.WriteString(v.String())
-		w.printf("\n")
-	default:
-		w.printf("const %s = %#v\n", name, x)
-	}
-}
-
-// WriteVar writes a variable of the given name and value.
-func (w *CodeWriter) WriteVar(name string, x interface{}) {
-	w.insertSep()
-	v := reflect.ValueOf(x)
-	oldSize := w.Size
-	sz := int(v.Type().Size())
-	w.Size += sz
-
-	switch v.Type().Kind() {
-	case reflect.String:
-		w.printf("var %s %s = ", name, typeName(x))
-		w.WriteString(v.String())
-	case reflect.Struct:
-		w.gob.Encode(x)
-		fallthrough
-	case reflect.Slice, reflect.Array:
-		w.printf("var %s = ", name)
-		w.writeValue(v)
-		w.writeSizeInfo(w.Size - oldSize)
-	default:
-		w.printf("var %s %s = ", name, typeName(x))
-		w.gob.Encode(x)
-		w.writeValue(v)
-		w.writeSizeInfo(w.Size - oldSize)
-	}
-	w.printf("\n")
-}
-
-func (w *CodeWriter) writeValue(v reflect.Value) {
-	x := v.Interface()
-	switch v.Kind() {
-	case reflect.String:
-		w.WriteString(v.String())
-	case reflect.Array:
-		// Don't double count: callers of WriteArray count on the size being
-		// added, so we need to discount it here.
-		w.Size -= int(v.Type().Size())
-		w.writeSlice(x, true)
-	case reflect.Slice:
-		w.writeSlice(x, false)
-	case reflect.Struct:
-		w.printf("%s{\n", typeName(v.Interface()))
-		t := v.Type()
-		for i := 0; i < v.NumField(); i++ {
-			w.printf("%s: ", t.Field(i).Name)
-			w.writeValue(v.Field(i))
-			w.printf(",\n")
-		}
-		w.printf("}")
-	default:
-		w.printf("%#v", x)
-	}
-}
-
-// WriteString writes a string literal.
-func (w *CodeWriter) WriteString(s string) {
-	io.WriteString(w.Hash, s) // content hash
-	w.Size += len(s)
-
-	const maxInline = 40
-	if len(s) <= maxInline {
-		w.printf("%q", s)
-		return
-	}
-
-	// We will render the string as a multi-line string.
-	const maxWidth = 80 - 4 - len(`"`) - len(`" +`)
-
-	// When starting on its own line, go fmt indents line 2+ an extra level.
-	n, max := maxWidth, maxWidth-4
-
-	// As per https://golang.org/issue/18078, the compiler has trouble
-	// compiling the concatenation of many strings, s0 + s1 + s2 + ... + sN,
-	// for large N. We insert redundant, explicit parentheses to work around
-	// that, lowering the N at any given step: (s0 + s1 + ... + s63) + (s64 +
-	// ... + s127) + etc + (etc + ... + sN).
-	explicitParens, extraComment := len(s) > 128*1024, ""
-	if explicitParens {
-		w.printf(`(`)
-		extraComment = "; the redundant, explicit parens are for https://golang.org/issue/18078"
-	}
-
-	// Print "" +\n, if a string does not start on its own line.
-	b := w.buf.Bytes()
-	if p := len(bytes.TrimRight(b, " \t")); p > 0 && b[p-1] != '\n' {
-		w.printf("\"\" + // Size: %d bytes%s\n", len(s), extraComment)
-		n, max = maxWidth, maxWidth
-	}
-
-	w.printf(`"`)
-
-	for sz, p, nLines := 0, 0, 0; p < len(s); {
-		var r rune
-		r, sz = utf8.DecodeRuneInString(s[p:])
-		out := s[p : p+sz]
-		chars := 1
-		if !unicode.IsPrint(r) || r == utf8.RuneError || r == '"' {
-			switch sz {
-			case 1:
-				out = fmt.Sprintf("\\x%02x", s[p])
-			case 2, 3:
-				out = fmt.Sprintf("\\u%04x", r)
-			case 4:
-				out = fmt.Sprintf("\\U%08x", r)
-			}
-			chars = len(out)
-		} else if r == '\\' {
-			out = "\\" + string(r)
-			chars = 2
-		}
-		if n -= chars; n < 0 {
-			nLines++
-			if explicitParens && nLines&63 == 63 {
-				w.printf("\") + (\"")
-			}
-			w.printf("\" +\n\"")
-			n = max - len(out)
-		}
-		w.printf("%s", out)
-		p += sz
-	}
-	w.printf(`"`)
-	if explicitParens {
-		w.printf(`)`)
-	}
-}
-
-// WriteSlice writes a slice value.
-func (w *CodeWriter) WriteSlice(x interface{}) {
-	w.writeSlice(x, false)
-}
-
-// WriteArray writes an array value.
-func (w *CodeWriter) WriteArray(x interface{}) {
-	w.writeSlice(x, true)
-}
-
-func (w *CodeWriter) writeSlice(x interface{}, isArray bool) {
-	v := reflect.ValueOf(x)
-	w.gob.Encode(v.Len())
-	w.Size += v.Len() * int(v.Type().Elem().Size())
-	name := typeName(x)
-	if isArray {
-		name = fmt.Sprintf("[%d]%s", v.Len(), name[strings.Index(name, "]")+1:])
-	}
-	if isArray {
-		w.printf("%s{\n", name)
-	} else {
-		w.printf("%s{ // %d elements\n", name, v.Len())
-	}
-
-	switch kind := v.Type().Elem().Kind(); kind {
-	case reflect.String:
-		for _, s := range x.([]string) {
-			w.WriteString(s)
-			w.printf(",\n")
-		}
-	case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64,
-		reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64:
-		// nLine and nBlock are the number of elements per line and block.
-		nLine, nBlock, format := 8, 64, "%d,"
-		switch kind {
-		case reflect.Uint8:
-			format = "%#02x,"
-		case reflect.Uint16:
-			format = "%#04x,"
-		case reflect.Uint32:
-			nLine, nBlock, format = 4, 32, "%#08x,"
-		case reflect.Uint, reflect.Uint64:
-			nLine, nBlock, format = 4, 32, "%#016x,"
-		case reflect.Int8:
-			nLine = 16
-		}
-		n := nLine
-		for i := 0; i < v.Len(); i++ {
-			if i%nBlock == 0 && v.Len() > nBlock {
-				w.printf("// Entry %X - %X\n", i, i+nBlock-1)
-			}
-			x := v.Index(i).Interface()
-			w.gob.Encode(x)
-			w.printf(format, x)
-			if n--; n == 0 {
-				n = nLine
-				w.printf("\n")
-			}
-		}
-		w.printf("\n")
-	case reflect.Struct:
-		zero := reflect.Zero(v.Type().Elem()).Interface()
-		for i := 0; i < v.Len(); i++ {
-			x := v.Index(i).Interface()
-			w.gob.EncodeValue(v)
-			if !reflect.DeepEqual(zero, x) {
-				line := fmt.Sprintf("%#v,\n", x)
-				line = line[strings.IndexByte(line, '{'):]
-				w.printf("%d: ", i)
-				w.printf(line)
-			}
-		}
-	case reflect.Array:
-		for i := 0; i < v.Len(); i++ {
-			w.printf("%d: %#v,\n", i, v.Index(i).Interface())
-		}
-	default:
-		panic("gen: slice elem type not supported")
-	}
-	w.printf("}")
-}
-
-// WriteType writes a definition of the type of the given value and returns the
-// type name.
-func (w *CodeWriter) WriteType(x interface{}) string {
-	t := reflect.TypeOf(x)
-	w.printf("type %s struct {\n", t.Name())
-	for i := 0; i < t.NumField(); i++ {
-		w.printf("\t%s %s\n", t.Field(i).Name, t.Field(i).Type)
-	}
-	w.printf("}\n")
-	return t.Name()
-}
-
-// typeName returns the name of the go type of x.
-func typeName(x interface{}) string {
-	t := reflect.ValueOf(x).Type()
-	return strings.Replace(fmt.Sprint(t), "main.", "", 1)
-}
diff --git a/vendor/golang.org/x/text/internal/gen/gen.go b/vendor/golang.org/x/text/internal/gen/gen.go
deleted file mode 100644
index 4c3f7606..00000000
--- a/vendor/golang.org/x/text/internal/gen/gen.go
+++ /dev/null
@@ -1,333 +0,0 @@
-// Copyright 2015 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package gen contains common code for the various code generation tools in the
-// text repository. Its usage ensures consistency between tools.
-//
-// This package defines command line flags that are common to most generation
-// tools. The flags allow for specifying specific Unicode and CLDR versions
-// in the public Unicode data repository (http://www.unicode.org/Public).
-//
-// A local Unicode data mirror can be set through the flag -local or the
-// environment variable UNICODE_DIR. The former takes precedence. The local
-// directory should follow the same structure as the public repository.
-//
-// IANA data can also optionally be mirrored by putting it in the iana directory
-// rooted at the top of the local mirror. Beware, though, that IANA data is not
-// versioned. So it is up to the developer to use the right version.
-package gen // import "golang.org/x/text/internal/gen"
-
-import (
-	"bytes"
-	"flag"
-	"fmt"
-	"go/build"
-	"go/format"
-	"io"
-	"io/ioutil"
-	"log"
-	"net/http"
-	"os"
-	"path"
-	"path/filepath"
-	"strings"
-	"sync"
-	"unicode"
-
-	"golang.org/x/text/unicode/cldr"
-)
-
-var (
-	url = flag.String("url",
-		"http://www.unicode.org/Public",
-		"URL of Unicode database directory")
-	iana = flag.String("iana",
-		"http://www.iana.org",
-		"URL of the IANA repository")
-	unicodeVersion = flag.String("unicode",
-		getEnv("UNICODE_VERSION", unicode.Version),
-		"unicode version to use")
-	cldrVersion = flag.String("cldr",
-		getEnv("CLDR_VERSION", cldr.Version),
-		"cldr version to use")
-)
-
-func getEnv(name, def string) string {
-	if v := os.Getenv(name); v != "" {
-		return v
-	}
-	return def
-}
-
-// Init performs common initialization for a gen command. It parses the flags
-// and sets up the standard logging parameters.
-func Init() {
-	log.SetPrefix("")
-	log.SetFlags(log.Lshortfile)
-	flag.Parse()
-}
-
-const header = `// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-`
-
-// UnicodeVersion reports the requested Unicode version.
-func UnicodeVersion() string {
-	return *unicodeVersion
-}
-
-// CLDRVersion reports the requested CLDR version.
-func CLDRVersion() string {
-	return *cldrVersion
-}
-
-var tags = []struct{ version, buildTags string }{
-	{"10.0.0", "go1.10"},
-	{"", "!go1.10"},
-}
-
-// buildTags reports the build tags used for the current Unicode version.
-func buildTags() string {
-	v := UnicodeVersion()
-	for _, x := range tags {
-		// We should do a numeric comparison, but including the collate package
-		// would create an import cycle. We approximate it by assuming that
-		// longer version strings are later.
-		if len(x.version) <= len(v) {
-			return x.buildTags
-		}
-		if len(x.version) == len(v) && x.version <= v {
-			return x.buildTags
-		}
-	}
-	return tags[0].buildTags
-}
-
-// IsLocal reports whether data files are available locally.
-func IsLocal() bool {
-	dir, err := localReadmeFile()
-	if err != nil {
-		return false
-	}
-	if _, err = os.Stat(dir); err != nil {
-		return false
-	}
-	return true
-}
-
-// OpenUCDFile opens the requested UCD file. The file is specified relative to
-// the public Unicode root directory. It will call log.Fatal if there are any
-// errors.
-func OpenUCDFile(file string) io.ReadCloser {
-	return openUnicode(path.Join(*unicodeVersion, "ucd", file))
-}
-
-// OpenCLDRCoreZip opens the CLDR core zip file. It will call log.Fatal if there
-// are any errors.
-func OpenCLDRCoreZip() io.ReadCloser {
-	return OpenUnicodeFile("cldr", *cldrVersion, "core.zip")
-}
-
-// OpenUnicodeFile opens the requested file of the requested category from the
-// root of the Unicode data archive. The file is specified relative to the
-// public Unicode root directory. If version is "", it will use the default
-// Unicode version. It will call log.Fatal if there are any errors.
-func OpenUnicodeFile(category, version, file string) io.ReadCloser {
-	if version == "" {
-		version = UnicodeVersion()
-	}
-	return openUnicode(path.Join(category, version, file))
-}
-
-// OpenIANAFile opens the requested IANA file. The file is specified relative
-// to the IANA root, which is typically either http://www.iana.org or the
-// iana directory in the local mirror. It will call log.Fatal if there are any
-// errors.
-func OpenIANAFile(path string) io.ReadCloser {
-	return Open(*iana, "iana", path)
-}
-
-var (
-	dirMutex sync.Mutex
-	localDir string
-)
-
-const permissions = 0755
-
-func localReadmeFile() (string, error) {
-	p, err := build.Import("golang.org/x/text", "", build.FindOnly)
-	if err != nil {
-		return "", fmt.Errorf("Could not locate package: %v", err)
-	}
-	return filepath.Join(p.Dir, "DATA", "README"), nil
-}
-
-func getLocalDir() string {
-	dirMutex.Lock()
-	defer dirMutex.Unlock()
-
-	readme, err := localReadmeFile()
-	if err != nil {
-		log.Fatal(err)
-	}
-	dir := filepath.Dir(readme)
-	if _, err := os.Stat(readme); err != nil {
-		if err := os.MkdirAll(dir, permissions); err != nil {
-			log.Fatalf("Could not create directory: %v", err)
-		}
-		ioutil.WriteFile(readme, []byte(readmeTxt), permissions)
-	}
-	return dir
-}
-
-const readmeTxt = `Generated by golang.org/x/text/internal/gen. DO NOT EDIT.
-
-This directory contains downloaded files used to generate the various tables
-in the golang.org/x/text subrepo.
-
-Note that the language subtag repo (iana/assignments/language-subtag-registry)
-and all other times in the iana subdirectory are not versioned and will need
-to be periodically manually updated. The easiest way to do this is to remove
-the entire iana directory. This is mostly of concern when updating the language
-package.
-`
-
-// Open opens subdir/path if a local directory is specified and the file exists,
-// where subdir is a directory relative to the local root, or fetches it from
-// urlRoot/path otherwise. It will call log.Fatal if there are any errors.
-func Open(urlRoot, subdir, path string) io.ReadCloser {
-	file := filepath.Join(getLocalDir(), subdir, filepath.FromSlash(path))
-	return open(file, urlRoot, path)
-}
-
-func openUnicode(path string) io.ReadCloser {
-	file := filepath.Join(getLocalDir(), filepath.FromSlash(path))
-	return open(file, *url, path)
-}
-
-// TODO: automatically periodically update non-versioned files.
-
-func open(file, urlRoot, path string) io.ReadCloser {
-	if f, err := os.Open(file); err == nil {
-		return f
-	}
-	r := get(urlRoot, path)
-	defer r.Close()
-	b, err := ioutil.ReadAll(r)
-	if err != nil {
-		log.Fatalf("Could not download file: %v", err)
-	}
-	os.MkdirAll(filepath.Dir(file), permissions)
-	if err := ioutil.WriteFile(file, b, permissions); err != nil {
-		log.Fatalf("Could not create file: %v", err)
-	}
-	return ioutil.NopCloser(bytes.NewReader(b))
-}
-
-func get(root, path string) io.ReadCloser {
-	url := root + "/" + path
-	fmt.Printf("Fetching %s...", url)
-	defer fmt.Println(" done.")
-	resp, err := http.Get(url)
-	if err != nil {
-		log.Fatalf("HTTP GET: %v", err)
-	}
-	if resp.StatusCode != 200 {
-		log.Fatalf("Bad GET status for %q: %q", url, resp.Status)
-	}
-	return resp.Body
-}
-
-// TODO: use Write*Version in all applicable packages.
-
-// WriteUnicodeVersion writes a constant for the Unicode version from which the
-// tables are generated.
-func WriteUnicodeVersion(w io.Writer) {
-	fmt.Fprintf(w, "// UnicodeVersion is the Unicode version from which the tables in this package are derived.\n")
-	fmt.Fprintf(w, "const UnicodeVersion = %q\n\n", UnicodeVersion())
-}
-
-// WriteCLDRVersion writes a constant for the CLDR version from which the
-// tables are generated.
-func WriteCLDRVersion(w io.Writer) {
-	fmt.Fprintf(w, "// CLDRVersion is the CLDR version from which the tables in this package are derived.\n")
-	fmt.Fprintf(w, "const CLDRVersion = %q\n\n", CLDRVersion())
-}
-
-// WriteGoFile prepends a standard file comment and package statement to the
-// given bytes, applies gofmt, and writes them to a file with the given name.
-// It will call log.Fatal if there are any errors.
-func WriteGoFile(filename, pkg string, b []byte) {
-	w, err := os.Create(filename)
-	if err != nil {
-		log.Fatalf("Could not create file %s: %v", filename, err)
-	}
-	defer w.Close()
-	if _, err = WriteGo(w, pkg, "", b); err != nil {
-		log.Fatalf("Error writing file %s: %v", filename, err)
-	}
-}
-
-func insertVersion(filename, version string) string {
-	suffix := ".go"
-	if strings.HasSuffix(filename, "_test.go") {
-		suffix = "_test.go"
-	}
-	return fmt.Sprint(filename[:len(filename)-len(suffix)], version, suffix)
-}
-
-// WriteVersionedGoFile prepends a standard file comment, adds build tags to
-// version the file for the current Unicode version, and package statement to
-// the given bytes, applies gofmt, and writes them to a file with the given
-// name. It will call log.Fatal if there are any errors.
-func WriteVersionedGoFile(filename, pkg string, b []byte) {
-	tags := buildTags()
-	if tags != "" {
-		filename = insertVersion(filename, UnicodeVersion())
-	}
-	w, err := os.Create(filename)
-	if err != nil {
-		log.Fatalf("Could not create file %s: %v", filename, err)
-	}
-	defer w.Close()
-	if _, err = WriteGo(w, pkg, tags, b); err != nil {
-		log.Fatalf("Error writing file %s: %v", filename, err)
-	}
-}
-
-// WriteGo prepends a standard file comment and package statement to the given
-// bytes, applies gofmt, and writes them to w.
-func WriteGo(w io.Writer, pkg, tags string, b []byte) (n int, err error) {
-	src := []byte(header)
-	if tags != "" {
-		src = append(src, fmt.Sprintf("// +build %s\n\n", tags)...)
-	}
-	src = append(src, fmt.Sprintf("package %s\n\n", pkg)...)
-	src = append(src, b...)
-	formatted, err := format.Source(src)
-	if err != nil {
-		// Print the generated code even in case of an error so that the
-		// returned error can be meaningfully interpreted.
-		n, _ = w.Write(src)
-		return n, err
-	}
-	return w.Write(formatted)
-}
-
-// Repackage rewrites a Go file from belonging to package main to belonging to
-// the given package.
-func Repackage(inFile, outFile, pkg string) {
-	src, err := ioutil.ReadFile(inFile)
-	if err != nil {
-		log.Fatalf("reading %s: %v", inFile, err)
-	}
-	const toDelete = "package main\n\n"
-	i := bytes.Index(src, []byte(toDelete))
-	if i < 0 {
-		log.Fatalf("Could not find %q in %s.", toDelete, inFile)
-	}
-	w := &bytes.Buffer{}
-	w.Write(src[i+len(toDelete):])
-	WriteGoFile(outFile, pkg, w.Bytes())
-}
diff --git a/vendor/golang.org/x/text/internal/language/LICENSE b/vendor/golang.org/x/text/internal/language/LICENSE
deleted file mode 100644
index 6a66aea5..00000000
--- a/vendor/golang.org/x/text/internal/language/LICENSE
+++ /dev/null
@@ -1,27 +0,0 @@
-Copyright (c) 2009 The Go Authors. All rights reserved.
-
-Redistribution and use in source and binary forms, with or without
-modification, are permitted provided that the following conditions are
-met:
-
-   * Redistributions of source code must retain the above copyright
-notice, this list of conditions and the following disclaimer.
-   * Redistributions in binary form must reproduce the above
-copyright notice, this list of conditions and the following disclaimer
-in the documentation and/or other materials provided with the
-distribution.
-   * Neither the name of Google Inc. nor the names of its
-contributors may be used to endorse or promote products derived from
-this software without specific prior written permission.
-
-THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS
-"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT
-LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR
-A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT
-OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL,
-SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT
-LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE,
-DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY
-THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT
-(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE
-OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go
deleted file mode 100644
index cdfdb749..00000000
--- a/vendor/golang.org/x/text/internal/language/common.go
+++ /dev/null
@@ -1,16 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package language
-
-// This file contains code common to the maketables.go and the package code.
-
-// AliasType is the type of an alias in AliasMap.
-type AliasType int8
-
-const (
-	Deprecated AliasType = iota
-	Macro
-	Legacy
-
-	AliasTypeUnknown AliasType = -1
-)
diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go
deleted file mode 100644
index 46a00150..00000000
--- a/vendor/golang.org/x/text/internal/language/compact.go
+++ /dev/null
@@ -1,29 +0,0 @@
-// Copyright 2018 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-// CompactCoreInfo is a compact integer with the three core tags encoded.
-type CompactCoreInfo uint32
-
-// GetCompactCore generates a uint32 value that is guaranteed to be unique for
-// different language, region, and script values.
-func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) {
-	if t.LangID > langNoIndexOffset {
-		return 0, false
-	}
-	cci |= CompactCoreInfo(t.LangID) << (8 + 12)
-	cci |= CompactCoreInfo(t.ScriptID) << 12
-	cci |= CompactCoreInfo(t.RegionID)
-	return cci, true
-}
-
-// Tag generates a tag from c.
-func (c CompactCoreInfo) Tag() Tag {
-	return Tag{
-		LangID:   Language(c >> 20),
-		RegionID: Region(c & 0x3ff),
-		ScriptID: Script(c>>12) & 0xff,
-	}
-}
diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go
deleted file mode 100644
index 1b36935e..00000000
--- a/vendor/golang.org/x/text/internal/language/compact/compact.go
+++ /dev/null
@@ -1,61 +0,0 @@
-// Copyright 2018 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package compact defines a compact representation of language tags.
-//
-// Common language tags (at least all for which locale information is defined
-// in CLDR) are assigned a unique index. Each Tag is associated with such an
-// ID for selecting language-related resources (such as translations) as well
-// as one for selecting regional defaults (currency, number formatting, etc.)
-//
-// It may want to export this functionality at some point, but at this point
-// this is only available for use within x/text.
-package compact // import "golang.org/x/text/internal/language/compact"
-
-import (
-	"sort"
-	"strings"
-
-	"golang.org/x/text/internal/language"
-)
-
-// ID is an integer identifying a single tag.
-type ID uint16
-
-func getCoreIndex(t language.Tag) (id ID, ok bool) {
-	cci, ok := language.GetCompactCore(t)
-	if !ok {
-		return 0, false
-	}
-	i := sort.Search(len(coreTags), func(i int) bool {
-		return cci <= coreTags[i]
-	})
-	if i == len(coreTags) || coreTags[i] != cci {
-		return 0, false
-	}
-	return ID(i), true
-}
-
-// Parent returns the ID of the parent or the root ID if id is already the root.
-func (id ID) Parent() ID {
-	return parents[id]
-}
-
-// Tag converts id to an internal language Tag.
-func (id ID) Tag() language.Tag {
-	if int(id) >= len(coreTags) {
-		return specialTags[int(id)-len(coreTags)]
-	}
-	return coreTags[id].Tag()
-}
-
-var specialTags []language.Tag
-
-func init() {
-	tags := strings.Split(specialTagsStr, " ")
-	specialTags = make([]language.Tag, len(tags))
-	for i, t := range tags {
-		specialTags[i] = language.MustParse(t)
-	}
-}
diff --git a/vendor/golang.org/x/text/internal/language/compact/gen.go b/vendor/golang.org/x/text/internal/language/compact/gen.go
deleted file mode 100644
index 0c36a052..00000000
--- a/vendor/golang.org/x/text/internal/language/compact/gen.go
+++ /dev/null
@@ -1,64 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build ignore
-
-// Language tag table generator.
-// Data read from the web.
-
-package main
-
-import (
-	"flag"
-	"fmt"
-	"log"
-
-	"golang.org/x/text/internal/gen"
-	"golang.org/x/text/unicode/cldr"
-)
-
-var (
-	test = flag.Bool("test",
-		false,
-		"test existing tables; can be used to compare web data with package data.")
-	outputFile = flag.String("output",
-		"tables.go",
-		"output file for generated tables")
-)
-
-func main() {
-	gen.Init()
-
-	w := gen.NewCodeWriter()
-	defer w.WriteGoFile("tables.go", "compact")
-
-	fmt.Fprintln(w, `import "golang.org/x/text/internal/language"`)
-
-	b := newBuilder(w)
-	gen.WriteCLDRVersion(w)
-
-	b.writeCompactIndex()
-}
-
-type builder struct {
-	w    *gen.CodeWriter
-	data *cldr.CLDR
-	supp *cldr.SupplementalData
-}
-
-func newBuilder(w *gen.CodeWriter) *builder {
-	r := gen.OpenCLDRCoreZip()
-	defer r.Close()
-	d := &cldr.Decoder{}
-	data, err := d.DecodeZip(r)
-	if err != nil {
-		log.Fatal(err)
-	}
-	b := builder{
-		w:    w,
-		data: data,
-		supp: data.Supplemental(),
-	}
-	return &b
-}
diff --git a/vendor/golang.org/x/text/internal/language/compact/gen_index.go b/vendor/golang.org/x/text/internal/language/compact/gen_index.go
deleted file mode 100644
index 136cefaf..00000000
--- a/vendor/golang.org/x/text/internal/language/compact/gen_index.go
+++ /dev/null
@@ -1,113 +0,0 @@
-// Copyright 2015 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build ignore
-
-package main
-
-// This file generates derivative tables based on the language package itself.
-
-import (
-	"fmt"
-	"log"
-	"sort"
-	"strings"
-
-	"golang.org/x/text/internal/language"
-)
-
-// Compact indices:
-// Note -va-X variants only apply to localization variants.
-// BCP variants only ever apply to language.
-// The only ambiguity between tags is with regions.
-
-func (b *builder) writeCompactIndex() {
-	// Collect all language tags for which we have any data in CLDR.
-	m := map[language.Tag]bool{}
-	for _, lang := range b.data.Locales() {
-		// We include all locales unconditionally to be consistent with en_US.
-		// We want en_US, even though it has no data associated with it.
-
-		// TODO: put any of the languages for which no data exists at the end
-		// of the index. This allows all components based on ICU to use that
-		// as the cutoff point.
-		// if x := data.RawLDML(lang); false ||
-		// 	x.LocaleDisplayNames != nil ||
-		// 	x.Characters != nil ||
-		// 	x.Delimiters != nil ||
-		// 	x.Measurement != nil ||
-		// 	x.Dates != nil ||
-		// 	x.Numbers != nil ||
-		// 	x.Units != nil ||
-		// 	x.ListPatterns != nil ||
-		// 	x.Collations != nil ||
-		// 	x.Segmentations != nil ||
-		// 	x.Rbnf != nil ||
-		// 	x.Annotations != nil ||
-		// 	x.Metadata != nil {
-
-		// TODO: support POSIX natively, albeit non-standard.
-		tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1))
-		m[tag] = true
-		// }
-	}
-
-	// TODO: plural rules are also defined for the deprecated tags:
-	//    iw mo sh tl
-	// Consider removing these as compact tags.
-
-	// Include locales for plural rules, which uses a different structure.
-	for _, plurals := range b.supp.Plurals {
-		for _, rules := range plurals.PluralRules {
-			for _, lang := range strings.Split(rules.Locales, " ") {
-				m[language.Make(lang)] = true
-			}
-		}
-	}
-
-	var coreTags []language.CompactCoreInfo
-	var special []string
-
-	for t := range m {
-		if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" {
-			log.Fatalf("Unexpected extension %v in %v", x, t)
-		}
-		if len(t.Variants()) == 0 && len(t.Extensions()) == 0 {
-			cci, ok := language.GetCompactCore(t)
-			if !ok {
-				log.Fatalf("Locale for non-basic language %q", t)
-			}
-			coreTags = append(coreTags, cci)
-		} else {
-			special = append(special, t.String())
-		}
-	}
-
-	w := b.w
-
-	sort.Slice(coreTags, func(i, j int) bool { return coreTags[i] < coreTags[j] })
-	sort.Strings(special)
-
-	w.WriteComment(`
-	NumCompactTags is the number of common tags. The maximum tag is
-	NumCompactTags-1.`)
-	w.WriteConst("NumCompactTags", len(m))
-
-	fmt.Fprintln(w, "const (")
-	for i, t := range coreTags {
-		fmt.Fprintf(w, "%s ID = %d\n", ident(t.Tag().String()), i)
-	}
-	for i, t := range special {
-		fmt.Fprintf(w, "%s ID = %d\n", ident(t), i+len(coreTags))
-	}
-	fmt.Fprintln(w, ")")
-
-	w.WriteVar("coreTags", coreTags)
-
-	w.WriteConst("specialTagsStr", strings.Join(special, " "))
-}
-
-func ident(s string) string {
-	return strings.Replace(s, "-", "", -1) + "Index"
-}
diff --git a/vendor/golang.org/x/text/internal/language/compact/gen_parents.go b/vendor/golang.org/x/text/internal/language/compact/gen_parents.go
deleted file mode 100644
index 9543d583..00000000
--- a/vendor/golang.org/x/text/internal/language/compact/gen_parents.go
+++ /dev/null
@@ -1,54 +0,0 @@
-// Copyright 2018 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build ignore
-
-package main
-
-import (
-	"log"
-
-	"golang.org/x/text/internal/gen"
-	"golang.org/x/text/internal/language"
-	"golang.org/x/text/internal/language/compact"
-	"golang.org/x/text/unicode/cldr"
-)
-
-func main() {
-	r := gen.OpenCLDRCoreZip()
-	defer r.Close()
-
-	d := &cldr.Decoder{}
-	data, err := d.DecodeZip(r)
-	if err != nil {
-		log.Fatalf("DecodeZip: %v", err)
-	}
-
-	w := gen.NewCodeWriter()
-	defer w.WriteGoFile("parents.go", "compact")
-
-	// Create parents table.
-	type ID uint16
-	parents := make([]ID, compact.NumCompactTags)
-	for _, loc := range data.Locales() {
-		tag := language.MustParse(loc)
-		index, ok := compact.FromTag(tag)
-		if !ok {
-			continue
-		}
-		parentIndex := compact.ID(0) // und
-		for p := tag.Parent(); p != language.Und; p = p.Parent() {
-			if x, ok := compact.FromTag(p); ok {
-				parentIndex = x
-				break
-			}
-		}
-		parents[index] = ID(parentIndex)
-	}
-
-	w.WriteComment(`
-	parents maps a compact index of a tag to the compact index of the parent of
-	this tag.`)
-	w.WriteVar("parents", parents)
-}
diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go
deleted file mode 100644
index 83816a72..00000000
--- a/vendor/golang.org/x/text/internal/language/compact/language.go
+++ /dev/null
@@ -1,260 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:generate go run gen.go gen_index.go -output tables.go
-//go:generate go run gen_parents.go
-
-package compact
-
-// TODO: Remove above NOTE after:
-// - verifying that tables are dropped correctly (most notably matcher tables).
-
-import (
-	"strings"
-
-	"golang.org/x/text/internal/language"
-)
-
-// Tag represents a BCP 47 language tag. It is used to specify an instance of a
-// specific language or locale. All language tag values are guaranteed to be
-// well-formed.
-type Tag struct {
-	// NOTE: exported tags will become part of the public API.
-	language ID
-	locale   ID
-	full     fullTag // always a language.Tag for now.
-}
-
-const _und = 0
-
-type fullTag interface {
-	IsRoot() bool
-	Parent() language.Tag
-}
-
-// Make a compact Tag from a fully specified internal language Tag.
-func Make(t language.Tag) (tag Tag) {
-	if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" {
-		if r, err := language.ParseRegion(region[:2]); err == nil {
-			tFull := t
-			t, _ = t.SetTypeForKey("rg", "")
-			// TODO: should we not consider "va" for the language tag?
-			var exact1, exact2 bool
-			tag.language, exact1 = FromTag(t)
-			t.RegionID = r
-			tag.locale, exact2 = FromTag(t)
-			if !exact1 || !exact2 {
-				tag.full = tFull
-			}
-			return tag
-		}
-	}
-	lang, ok := FromTag(t)
-	tag.language = lang
-	tag.locale = lang
-	if !ok {
-		tag.full = t
-	}
-	return tag
-}
-
-// Tag returns an internal language Tag version of this tag.
-func (t Tag) Tag() language.Tag {
-	if t.full != nil {
-		return t.full.(language.Tag)
-	}
-	tag := t.language.Tag()
-	if t.language != t.locale {
-		loc := t.locale.Tag()
-		tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz")
-	}
-	return tag
-}
-
-// IsCompact reports whether this tag is fully defined in terms of ID.
-func (t *Tag) IsCompact() bool {
-	return t.full == nil
-}
-
-// MayHaveVariants reports whether a tag may have variants. If it returns false
-// it is guaranteed the tag does not have variants.
-func (t Tag) MayHaveVariants() bool {
-	return t.full != nil || int(t.language) >= len(coreTags)
-}
-
-// MayHaveExtensions reports whether a tag may have extensions. If it returns
-// false it is guaranteed the tag does not have them.
-func (t Tag) MayHaveExtensions() bool {
-	return t.full != nil ||
-		int(t.language) >= len(coreTags) ||
-		t.language != t.locale
-}
-
-// IsRoot returns true if t is equal to language "und".
-func (t Tag) IsRoot() bool {
-	if t.full != nil {
-		return t.full.IsRoot()
-	}
-	return t.language == _und
-}
-
-// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
-// specific language are substituted with fields from the parent language.
-// The parent for a language may change for newer versions of CLDR.
-func (t Tag) Parent() Tag {
-	if t.full != nil {
-		return Make(t.full.Parent())
-	}
-	if t.language != t.locale {
-		// Simulate stripping -u-rg-xxxxxx
-		return Tag{language: t.language, locale: t.language}
-	}
-	// TODO: use parent lookup table once cycle from internal package is
-	// removed. Probably by internalizing the table and declaring this fast
-	// enough.
-	// lang := compactID(internal.Parent(uint16(t.language)))
-	lang, _ := FromTag(t.language.Tag().Parent())
-	return Tag{language: lang, locale: lang}
-}
-
-// returns token t and the rest of the string.
-func nextToken(s string) (t, tail string) {
-	p := strings.Index(s[1:], "-")
-	if p == -1 {
-		return s[1:], ""
-	}
-	p++
-	return s[1:p], s[p:]
-}
-
-// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags
-// for which data exists in the text repository.The index will change over time
-// and should not be stored in persistent storage. If t does not match a compact
-// index, exact will be false and the compact index will be returned for the
-// first match after repeatedly taking the Parent of t.
-func LanguageID(t Tag) (id ID, exact bool) {
-	return t.language, t.full == nil
-}
-
-// RegionalID returns the ID for the regional variant of this tag. This index is
-// used to indicate region-specific overrides, such as default currency, default
-// calendar and week data, default time cycle, and default measurement system
-// and unit preferences.
-//
-// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US
-// settings for currency, number formatting, etc. The CompactIndex for this tag
-// will be that for en-GB, while the RegionalID will be the one corresponding to
-// en-US.
-func RegionalID(t Tag) (id ID, exact bool) {
-	return t.locale, t.full == nil
-}
-
-// LanguageTag returns t stripped of regional variant indicators.
-//
-// At the moment this means it is stripped of a regional and variant subtag "rg"
-// and "va" in the "u" extension.
-func (t Tag) LanguageTag() Tag {
-	if t.full == nil {
-		return Tag{language: t.language, locale: t.language}
-	}
-	tt := t.Tag()
-	tt.SetTypeForKey("rg", "")
-	tt.SetTypeForKey("va", "")
-	return Make(tt)
-}
-
-// RegionalTag returns the regional variant of the tag.
-//
-// At the moment this means that the region is set from the regional subtag
-// "rg" in the "u" extension.
-func (t Tag) RegionalTag() Tag {
-	rt := Tag{language: t.locale, locale: t.locale}
-	if t.full == nil {
-		return rt
-	}
-	b := language.Builder{}
-	tag := t.Tag()
-	// tag, _ = tag.SetTypeForKey("rg", "")
-	b.SetTag(t.locale.Tag())
-	if v := tag.Variants(); v != "" {
-		for _, v := range strings.Split(v, "-") {
-			b.AddVariant(v)
-		}
-	}
-	for _, e := range tag.Extensions() {
-		b.AddExt(e)
-	}
-	return t
-}
-
-// FromTag reports closest matching ID for an internal language Tag.
-func FromTag(t language.Tag) (id ID, exact bool) {
-	// TODO: perhaps give more frequent tags a lower index.
-	// TODO: we could make the indexes stable. This will excluded some
-	//       possibilities for optimization, so don't do this quite yet.
-	exact = true
-
-	b, s, r := t.Raw()
-	if t.HasString() {
-		if t.IsPrivateUse() {
-			// We have no entries for user-defined tags.
-			return 0, false
-		}
-		hasExtra := false
-		if t.HasVariants() {
-			if t.HasExtensions() {
-				build := language.Builder{}
-				build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r})
-				build.AddVariant(t.Variants())
-				exact = false
-				t = build.Make()
-			}
-			hasExtra = true
-		} else if _, ok := t.Extension('u'); ok {
-			// TODO: va may mean something else. Consider not considering it.
-			// Strip all but the 'va' entry.
-			old := t
-			variant := t.TypeForKey("va")
-			t = language.Tag{LangID: b, ScriptID: s, RegionID: r}
-			if variant != "" {
-				t, _ = t.SetTypeForKey("va", variant)
-				hasExtra = true
-			}
-			exact = old == t
-		} else {
-			exact = false
-		}
-		if hasExtra {
-			// We have some variants.
-			for i, s := range specialTags {
-				if s == t {
-					return ID(i + len(coreTags)), exact
-				}
-			}
-			exact = false
-		}
-	}
-	if x, ok := getCoreIndex(t); ok {
-		return x, exact
-	}
-	exact = false
-	if r != 0 && s == 0 {
-		// Deal with cases where an extra script is inserted for the region.
-		t, _ := t.Maximize()
-		if x, ok := getCoreIndex(t); ok {
-			return x, exact
-		}
-	}
-	for t = t.Parent(); t != root; t = t.Parent() {
-		// No variants specified: just compare core components.
-		// The key has the form lllssrrr, where l, s, and r are nibbles for
-		// respectively the langID, scriptID, and regionID.
-		if x, ok := getCoreIndex(t); ok {
-			return x, exact
-		}
-	}
-	return 0, exact
-}
-
-var root = language.Tag{}
diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go
deleted file mode 100644
index 8d810723..00000000
--- a/vendor/golang.org/x/text/internal/language/compact/parents.go
+++ /dev/null
@@ -1,120 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package compact
-
-// parents maps a compact index of a tag to the compact index of the parent of
-// this tag.
-var parents = []ID{ // 775 elements
-	// Entry 0 - 3F
-	0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006,
-	0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
-	0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
-	0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a,
-	0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000,
-	0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000,
-	0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000,
-	0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e,
-	// Entry 40 - 7F
-	0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046,
-	0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000,
-	0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000,
-	0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d,
-	0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066,
-	0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b,
-	0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000,
-	0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e,
-	// Entry 80 - BF
-	0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086,
-	0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087,
-	0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088,
-	0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087,
-	0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
-	0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087,
-	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
-	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086,
-	// Entry C0 - FF
-	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
-	0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
-	0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087,
-	0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087,
-	0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087,
-	0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000,
-	0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2,
-	0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1,
-	// Entry 100 - 13F
-	0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1,
-	0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e,
-	0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000,
-	0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e,
-	0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123,
-	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
-	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
-	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
-	// Entry 140 - 17F
-	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
-	0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123,
-	0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156,
-	0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c,
-	0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000,
-	0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000,
-	0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176,
-	0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e,
-	// Entry 180 - 1BF
-	0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184,
-	0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e,
-	0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000,
-	0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000,
-	0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000,
-	0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000,
-	0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6,
-	0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000,
-	// Entry 1C0 - 1FF
-	0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000,
-	0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb,
-	0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000,
-	0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000,
-	0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6,
-	0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee,
-	0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5,
-	0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000,
-	// Entry 200 - 23F
-	0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000,
-	0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000,
-	0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000,
-	0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000,
-	0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226,
-	0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000,
-	0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236,
-	0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244,
-	// Entry 240 - 27F
-	0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000,
-	0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000,
-	0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254,
-	0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000,
-	0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000,
-	0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e,
-	0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273,
-	0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000,
-	// Entry 280 - 2BF
-	0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286,
-	0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000,
-	0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295,
-	0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d,
-	0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000,
-	0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae,
-	0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5,
-	0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000,
-	// Entry 2C0 - 2FF
-	0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000,
-	0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd,
-	0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000,
-	0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000,
-	0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6,
-	0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000,
-	0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000,
-	0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000,
-	// Entry 300 - 33F
-	0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6,
-} // Size: 1574 bytes
-
-// Total table size 1574 bytes (1KiB); checksum: 895AAF0B
diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go
deleted file mode 100644
index 554ca354..00000000
--- a/vendor/golang.org/x/text/internal/language/compact/tables.go
+++ /dev/null
@@ -1,1015 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package compact
-
-import "golang.org/x/text/internal/language"
-
-// CLDRVersion is the CLDR version from which the tables in this package are derived.
-const CLDRVersion = "32"
-
-// NumCompactTags is the number of common tags. The maximum tag is
-// NumCompactTags-1.
-const NumCompactTags = 775
-const (
-	undIndex          ID = 0
-	afIndex           ID = 1
-	afNAIndex         ID = 2
-	afZAIndex         ID = 3
-	agqIndex          ID = 4
-	agqCMIndex        ID = 5
-	akIndex           ID = 6
-	akGHIndex         ID = 7
-	amIndex           ID = 8
-	amETIndex         ID = 9
-	arIndex           ID = 10
-	ar001Index        ID = 11
-	arAEIndex         ID = 12
-	arBHIndex         ID = 13
-	arDJIndex         ID = 14
-	arDZIndex         ID = 15
-	arEGIndex         ID = 16
-	arEHIndex         ID = 17
-	arERIndex         ID = 18
-	arILIndex         ID = 19
-	arIQIndex         ID = 20
-	arJOIndex         ID = 21
-	arKMIndex         ID = 22
-	arKWIndex         ID = 23
-	arLBIndex         ID = 24
-	arLYIndex         ID = 25
-	arMAIndex         ID = 26
-	arMRIndex         ID = 27
-	arOMIndex         ID = 28
-	arPSIndex         ID = 29
-	arQAIndex         ID = 30
-	arSAIndex         ID = 31
-	arSDIndex         ID = 32
-	arSOIndex         ID = 33
-	arSSIndex         ID = 34
-	arSYIndex         ID = 35
-	arTDIndex         ID = 36
-	arTNIndex         ID = 37
-	arYEIndex         ID = 38
-	arsIndex          ID = 39
-	asIndex           ID = 40
-	asINIndex         ID = 41
-	asaIndex          ID = 42
-	asaTZIndex        ID = 43
-	astIndex          ID = 44
-	astESIndex        ID = 45
-	azIndex           ID = 46
-	azCyrlIndex       ID = 47
-	azCyrlAZIndex     ID = 48
-	azLatnIndex       ID = 49
-	azLatnAZIndex     ID = 50
-	basIndex          ID = 51
-	basCMIndex        ID = 52
-	beIndex           ID = 53
-	beBYIndex         ID = 54
-	bemIndex          ID = 55
-	bemZMIndex        ID = 56
-	bezIndex          ID = 57
-	bezTZIndex        ID = 58
-	bgIndex           ID = 59
-	bgBGIndex         ID = 60
-	bhIndex           ID = 61
-	bmIndex           ID = 62
-	bmMLIndex         ID = 63
-	bnIndex           ID = 64
-	bnBDIndex         ID = 65
-	bnINIndex         ID = 66
-	boIndex           ID = 67
-	boCNIndex         ID = 68
-	boINIndex         ID = 69
-	brIndex           ID = 70
-	brFRIndex         ID = 71
-	brxIndex          ID = 72
-	brxINIndex        ID = 73
-	bsIndex           ID = 74
-	bsCyrlIndex       ID = 75
-	bsCyrlBAIndex     ID = 76
-	bsLatnIndex       ID = 77
-	bsLatnBAIndex     ID = 78
-	caIndex           ID = 79
-	caADIndex         ID = 80
-	caESIndex         ID = 81
-	caFRIndex         ID = 82
-	caITIndex         ID = 83
-	ccpIndex          ID = 84
-	ccpBDIndex        ID = 85
-	ccpINIndex        ID = 86
-	ceIndex           ID = 87
-	ceRUIndex         ID = 88
-	cggIndex          ID = 89
-	cggUGIndex        ID = 90
-	chrIndex          ID = 91
-	chrUSIndex        ID = 92
-	ckbIndex          ID = 93
-	ckbIQIndex        ID = 94
-	ckbIRIndex        ID = 95
-	csIndex           ID = 96
-	csCZIndex         ID = 97
-	cuIndex           ID = 98
-	cuRUIndex         ID = 99
-	cyIndex           ID = 100
-	cyGBIndex         ID = 101
-	daIndex           ID = 102
-	daDKIndex         ID = 103
-	daGLIndex         ID = 104
-	davIndex          ID = 105
-	davKEIndex        ID = 106
-	deIndex           ID = 107
-	deATIndex         ID = 108
-	deBEIndex         ID = 109
-	deCHIndex         ID = 110
-	deDEIndex         ID = 111
-	deITIndex         ID = 112
-	deLIIndex         ID = 113
-	deLUIndex         ID = 114
-	djeIndex          ID = 115
-	djeNEIndex        ID = 116
-	dsbIndex          ID = 117
-	dsbDEIndex        ID = 118
-	duaIndex          ID = 119
-	duaCMIndex        ID = 120
-	dvIndex           ID = 121
-	dyoIndex          ID = 122
-	dyoSNIndex        ID = 123
-	dzIndex           ID = 124
-	dzBTIndex         ID = 125
-	ebuIndex          ID = 126
-	ebuKEIndex        ID = 127
-	eeIndex           ID = 128
-	eeGHIndex         ID = 129
-	eeTGIndex         ID = 130
-	elIndex           ID = 131
-	elCYIndex         ID = 132
-	elGRIndex         ID = 133
-	enIndex           ID = 134
-	en001Index        ID = 135
-	en150Index        ID = 136
-	enAGIndex         ID = 137
-	enAIIndex         ID = 138
-	enASIndex         ID = 139
-	enATIndex         ID = 140
-	enAUIndex         ID = 141
-	enBBIndex         ID = 142
-	enBEIndex         ID = 143
-	enBIIndex         ID = 144
-	enBMIndex         ID = 145
-	enBSIndex         ID = 146
-	enBWIndex         ID = 147
-	enBZIndex         ID = 148
-	enCAIndex         ID = 149
-	enCCIndex         ID = 150
-	enCHIndex         ID = 151
-	enCKIndex         ID = 152
-	enCMIndex         ID = 153
-	enCXIndex         ID = 154
-	enCYIndex         ID = 155
-	enDEIndex         ID = 156
-	enDGIndex         ID = 157
-	enDKIndex         ID = 158
-	enDMIndex         ID = 159
-	enERIndex         ID = 160
-	enFIIndex         ID = 161
-	enFJIndex         ID = 162
-	enFKIndex         ID = 163
-	enFMIndex         ID = 164
-	enGBIndex         ID = 165
-	enGDIndex         ID = 166
-	enGGIndex         ID = 167
-	enGHIndex         ID = 168
-	enGIIndex         ID = 169
-	enGMIndex         ID = 170
-	enGUIndex         ID = 171
-	enGYIndex         ID = 172
-	enHKIndex         ID = 173
-	enIEIndex         ID = 174
-	enILIndex         ID = 175
-	enIMIndex         ID = 176
-	enINIndex         ID = 177
-	enIOIndex         ID = 178
-	enJEIndex         ID = 179
-	enJMIndex         ID = 180
-	enKEIndex         ID = 181
-	enKIIndex         ID = 182
-	enKNIndex         ID = 183
-	enKYIndex         ID = 184
-	enLCIndex         ID = 185
-	enLRIndex         ID = 186
-	enLSIndex         ID = 187
-	enMGIndex         ID = 188
-	enMHIndex         ID = 189
-	enMOIndex         ID = 190
-	enMPIndex         ID = 191
-	enMSIndex         ID = 192
-	enMTIndex         ID = 193
-	enMUIndex         ID = 194
-	enMWIndex         ID = 195
-	enMYIndex         ID = 196
-	enNAIndex         ID = 197
-	enNFIndex         ID = 198
-	enNGIndex         ID = 199
-	enNLIndex         ID = 200
-	enNRIndex         ID = 201
-	enNUIndex         ID = 202
-	enNZIndex         ID = 203
-	enPGIndex         ID = 204
-	enPHIndex         ID = 205
-	enPKIndex         ID = 206
-	enPNIndex         ID = 207
-	enPRIndex         ID = 208
-	enPWIndex         ID = 209
-	enRWIndex         ID = 210
-	enSBIndex         ID = 211
-	enSCIndex         ID = 212
-	enSDIndex         ID = 213
-	enSEIndex         ID = 214
-	enSGIndex         ID = 215
-	enSHIndex         ID = 216
-	enSIIndex         ID = 217
-	enSLIndex         ID = 218
-	enSSIndex         ID = 219
-	enSXIndex         ID = 220
-	enSZIndex         ID = 221
-	enTCIndex         ID = 222
-	enTKIndex         ID = 223
-	enTOIndex         ID = 224
-	enTTIndex         ID = 225
-	enTVIndex         ID = 226
-	enTZIndex         ID = 227
-	enUGIndex         ID = 228
-	enUMIndex         ID = 229
-	enUSIndex         ID = 230
-	enVCIndex         ID = 231
-	enVGIndex         ID = 232
-	enVIIndex         ID = 233
-	enVUIndex         ID = 234
-	enWSIndex         ID = 235
-	enZAIndex         ID = 236
-	enZMIndex         ID = 237
-	enZWIndex         ID = 238
-	eoIndex           ID = 239
-	eo001Index        ID = 240
-	esIndex           ID = 241
-	es419Index        ID = 242
-	esARIndex         ID = 243
-	esBOIndex         ID = 244
-	esBRIndex         ID = 245
-	esBZIndex         ID = 246
-	esCLIndex         ID = 247
-	esCOIndex         ID = 248
-	esCRIndex         ID = 249
-	esCUIndex         ID = 250
-	esDOIndex         ID = 251
-	esEAIndex         ID = 252
-	esECIndex         ID = 253
-	esESIndex         ID = 254
-	esGQIndex         ID = 255
-	esGTIndex         ID = 256
-	esHNIndex         ID = 257
-	esICIndex         ID = 258
-	esMXIndex         ID = 259
-	esNIIndex         ID = 260
-	esPAIndex         ID = 261
-	esPEIndex         ID = 262
-	esPHIndex         ID = 263
-	esPRIndex         ID = 264
-	esPYIndex         ID = 265
-	esSVIndex         ID = 266
-	esUSIndex         ID = 267
-	esUYIndex         ID = 268
-	esVEIndex         ID = 269
-	etIndex           ID = 270
-	etEEIndex         ID = 271
-	euIndex           ID = 272
-	euESIndex         ID = 273
-	ewoIndex          ID = 274
-	ewoCMIndex        ID = 275
-	faIndex           ID = 276
-	faAFIndex         ID = 277
-	faIRIndex         ID = 278
-	ffIndex           ID = 279
-	ffCMIndex         ID = 280
-	ffGNIndex         ID = 281
-	ffMRIndex         ID = 282
-	ffSNIndex         ID = 283
-	fiIndex           ID = 284
-	fiFIIndex         ID = 285
-	filIndex          ID = 286
-	filPHIndex        ID = 287
-	foIndex           ID = 288
-	foDKIndex         ID = 289
-	foFOIndex         ID = 290
-	frIndex           ID = 291
-	frBEIndex         ID = 292
-	frBFIndex         ID = 293
-	frBIIndex         ID = 294
-	frBJIndex         ID = 295
-	frBLIndex         ID = 296
-	frCAIndex         ID = 297
-	frCDIndex         ID = 298
-	frCFIndex         ID = 299
-	frCGIndex         ID = 300
-	frCHIndex         ID = 301
-	frCIIndex         ID = 302
-	frCMIndex         ID = 303
-	frDJIndex         ID = 304
-	frDZIndex         ID = 305
-	frFRIndex         ID = 306
-	frGAIndex         ID = 307
-	frGFIndex         ID = 308
-	frGNIndex         ID = 309
-	frGPIndex         ID = 310
-	frGQIndex         ID = 311
-	frHTIndex         ID = 312
-	frKMIndex         ID = 313
-	frLUIndex         ID = 314
-	frMAIndex         ID = 315
-	frMCIndex         ID = 316
-	frMFIndex         ID = 317
-	frMGIndex         ID = 318
-	frMLIndex         ID = 319
-	frMQIndex         ID = 320
-	frMRIndex         ID = 321
-	frMUIndex         ID = 322
-	frNCIndex         ID = 323
-	frNEIndex         ID = 324
-	frPFIndex         ID = 325
-	frPMIndex         ID = 326
-	frREIndex         ID = 327
-	frRWIndex         ID = 328
-	frSCIndex         ID = 329
-	frSNIndex         ID = 330
-	frSYIndex         ID = 331
-	frTDIndex         ID = 332
-	frTGIndex         ID = 333
-	frTNIndex         ID = 334
-	frVUIndex         ID = 335
-	frWFIndex         ID = 336
-	frYTIndex         ID = 337
-	furIndex          ID = 338
-	furITIndex        ID = 339
-	fyIndex           ID = 340
-	fyNLIndex         ID = 341
-	gaIndex           ID = 342
-	gaIEIndex         ID = 343
-	gdIndex           ID = 344
-	gdGBIndex         ID = 345
-	glIndex           ID = 346
-	glESIndex         ID = 347
-	gswIndex          ID = 348
-	gswCHIndex        ID = 349
-	gswFRIndex        ID = 350
-	gswLIIndex        ID = 351
-	guIndex           ID = 352
-	guINIndex         ID = 353
-	guwIndex          ID = 354
-	guzIndex          ID = 355
-	guzKEIndex        ID = 356
-	gvIndex           ID = 357
-	gvIMIndex         ID = 358
-	haIndex           ID = 359
-	haGHIndex         ID = 360
-	haNEIndex         ID = 361
-	haNGIndex         ID = 362
-	hawIndex          ID = 363
-	hawUSIndex        ID = 364
-	heIndex           ID = 365
-	heILIndex         ID = 366
-	hiIndex           ID = 367
-	hiINIndex         ID = 368
-	hrIndex           ID = 369
-	hrBAIndex         ID = 370
-	hrHRIndex         ID = 371
-	hsbIndex          ID = 372
-	hsbDEIndex        ID = 373
-	huIndex           ID = 374
-	huHUIndex         ID = 375
-	hyIndex           ID = 376
-	hyAMIndex         ID = 377
-	idIndex           ID = 378
-	idIDIndex         ID = 379
-	igIndex           ID = 380
-	igNGIndex         ID = 381
-	iiIndex           ID = 382
-	iiCNIndex         ID = 383
-	inIndex           ID = 384
-	ioIndex           ID = 385
-	isIndex           ID = 386
-	isISIndex         ID = 387
-	itIndex           ID = 388
-	itCHIndex         ID = 389
-	itITIndex         ID = 390
-	itSMIndex         ID = 391
-	itVAIndex         ID = 392
-	iuIndex           ID = 393
-	iwIndex           ID = 394
-	jaIndex           ID = 395
-	jaJPIndex         ID = 396
-	jboIndex          ID = 397
-	jgoIndex          ID = 398
-	jgoCMIndex        ID = 399
-	jiIndex           ID = 400
-	jmcIndex          ID = 401
-	jmcTZIndex        ID = 402
-	jvIndex           ID = 403
-	jwIndex           ID = 404
-	kaIndex           ID = 405
-	kaGEIndex         ID = 406
-	kabIndex          ID = 407
-	kabDZIndex        ID = 408
-	kajIndex          ID = 409
-	kamIndex          ID = 410
-	kamKEIndex        ID = 411
-	kcgIndex          ID = 412
-	kdeIndex          ID = 413
-	kdeTZIndex        ID = 414
-	keaIndex          ID = 415
-	keaCVIndex        ID = 416
-	khqIndex          ID = 417
-	khqMLIndex        ID = 418
-	kiIndex           ID = 419
-	kiKEIndex         ID = 420
-	kkIndex           ID = 421
-	kkKZIndex         ID = 422
-	kkjIndex          ID = 423
-	kkjCMIndex        ID = 424
-	klIndex           ID = 425
-	klGLIndex         ID = 426
-	klnIndex          ID = 427
-	klnKEIndex        ID = 428
-	kmIndex           ID = 429
-	kmKHIndex         ID = 430
-	knIndex           ID = 431
-	knINIndex         ID = 432
-	koIndex           ID = 433
-	koKPIndex         ID = 434
-	koKRIndex         ID = 435
-	kokIndex          ID = 436
-	kokINIndex        ID = 437
-	ksIndex           ID = 438
-	ksINIndex         ID = 439
-	ksbIndex          ID = 440
-	ksbTZIndex        ID = 441
-	ksfIndex          ID = 442
-	ksfCMIndex        ID = 443
-	kshIndex          ID = 444
-	kshDEIndex        ID = 445
-	kuIndex           ID = 446
-	kwIndex           ID = 447
-	kwGBIndex         ID = 448
-	kyIndex           ID = 449
-	kyKGIndex         ID = 450
-	lagIndex          ID = 451
-	lagTZIndex        ID = 452
-	lbIndex           ID = 453
-	lbLUIndex         ID = 454
-	lgIndex           ID = 455
-	lgUGIndex         ID = 456
-	lktIndex          ID = 457
-	lktUSIndex        ID = 458
-	lnIndex           ID = 459
-	lnAOIndex         ID = 460
-	lnCDIndex         ID = 461
-	lnCFIndex         ID = 462
-	lnCGIndex         ID = 463
-	loIndex           ID = 464
-	loLAIndex         ID = 465
-	lrcIndex          ID = 466
-	lrcIQIndex        ID = 467
-	lrcIRIndex        ID = 468
-	ltIndex           ID = 469
-	ltLTIndex         ID = 470
-	luIndex           ID = 471
-	luCDIndex         ID = 472
-	luoIndex          ID = 473
-	luoKEIndex        ID = 474
-	luyIndex          ID = 475
-	luyKEIndex        ID = 476
-	lvIndex           ID = 477
-	lvLVIndex         ID = 478
-	masIndex          ID = 479
-	masKEIndex        ID = 480
-	masTZIndex        ID = 481
-	merIndex          ID = 482
-	merKEIndex        ID = 483
-	mfeIndex          ID = 484
-	mfeMUIndex        ID = 485
-	mgIndex           ID = 486
-	mgMGIndex         ID = 487
-	mghIndex          ID = 488
-	mghMZIndex        ID = 489
-	mgoIndex          ID = 490
-	mgoCMIndex        ID = 491
-	mkIndex           ID = 492
-	mkMKIndex         ID = 493
-	mlIndex           ID = 494
-	mlINIndex         ID = 495
-	mnIndex           ID = 496
-	mnMNIndex         ID = 497
-	moIndex           ID = 498
-	mrIndex           ID = 499
-	mrINIndex         ID = 500
-	msIndex           ID = 501
-	msBNIndex         ID = 502
-	msMYIndex         ID = 503
-	msSGIndex         ID = 504
-	mtIndex           ID = 505
-	mtMTIndex         ID = 506
-	muaIndex          ID = 507
-	muaCMIndex        ID = 508
-	myIndex           ID = 509
-	myMMIndex         ID = 510
-	mznIndex          ID = 511
-	mznIRIndex        ID = 512
-	nahIndex          ID = 513
-	naqIndex          ID = 514
-	naqNAIndex        ID = 515
-	nbIndex           ID = 516
-	nbNOIndex         ID = 517
-	nbSJIndex         ID = 518
-	ndIndex           ID = 519
-	ndZWIndex         ID = 520
-	ndsIndex          ID = 521
-	ndsDEIndex        ID = 522
-	ndsNLIndex        ID = 523
-	neIndex           ID = 524
-	neINIndex         ID = 525
-	neNPIndex         ID = 526
-	nlIndex           ID = 527
-	nlAWIndex         ID = 528
-	nlBEIndex         ID = 529
-	nlBQIndex         ID = 530
-	nlCWIndex         ID = 531
-	nlNLIndex         ID = 532
-	nlSRIndex         ID = 533
-	nlSXIndex         ID = 534
-	nmgIndex          ID = 535
-	nmgCMIndex        ID = 536
-	nnIndex           ID = 537
-	nnNOIndex         ID = 538
-	nnhIndex          ID = 539
-	nnhCMIndex        ID = 540
-	noIndex           ID = 541
-	nqoIndex          ID = 542
-	nrIndex           ID = 543
-	nsoIndex          ID = 544
-	nusIndex          ID = 545
-	nusSSIndex        ID = 546
-	nyIndex           ID = 547
-	nynIndex          ID = 548
-	nynUGIndex        ID = 549
-	omIndex           ID = 550
-	omETIndex         ID = 551
-	omKEIndex         ID = 552
-	orIndex           ID = 553
-	orINIndex         ID = 554
-	osIndex           ID = 555
-	osGEIndex         ID = 556
-	osRUIndex         ID = 557
-	paIndex           ID = 558
-	paArabIndex       ID = 559
-	paArabPKIndex     ID = 560
-	paGuruIndex       ID = 561
-	paGuruINIndex     ID = 562
-	papIndex          ID = 563
-	plIndex           ID = 564
-	plPLIndex         ID = 565
-	prgIndex          ID = 566
-	prg001Index       ID = 567
-	psIndex           ID = 568
-	psAFIndex         ID = 569
-	ptIndex           ID = 570
-	ptAOIndex         ID = 571
-	ptBRIndex         ID = 572
-	ptCHIndex         ID = 573
-	ptCVIndex         ID = 574
-	ptGQIndex         ID = 575
-	ptGWIndex         ID = 576
-	ptLUIndex         ID = 577
-	ptMOIndex         ID = 578
-	ptMZIndex         ID = 579
-	ptPTIndex         ID = 580
-	ptSTIndex         ID = 581
-	ptTLIndex         ID = 582
-	quIndex           ID = 583
-	quBOIndex         ID = 584
-	quECIndex         ID = 585
-	quPEIndex         ID = 586
-	rmIndex           ID = 587
-	rmCHIndex         ID = 588
-	rnIndex           ID = 589
-	rnBIIndex         ID = 590
-	roIndex           ID = 591
-	roMDIndex         ID = 592
-	roROIndex         ID = 593
-	rofIndex          ID = 594
-	rofTZIndex        ID = 595
-	ruIndex           ID = 596
-	ruBYIndex         ID = 597
-	ruKGIndex         ID = 598
-	ruKZIndex         ID = 599
-	ruMDIndex         ID = 600
-	ruRUIndex         ID = 601
-	ruUAIndex         ID = 602
-	rwIndex           ID = 603
-	rwRWIndex         ID = 604
-	rwkIndex          ID = 605
-	rwkTZIndex        ID = 606
-	sahIndex          ID = 607
-	sahRUIndex        ID = 608
-	saqIndex          ID = 609
-	saqKEIndex        ID = 610
-	sbpIndex          ID = 611
-	sbpTZIndex        ID = 612
-	sdIndex           ID = 613
-	sdPKIndex         ID = 614
-	sdhIndex          ID = 615
-	seIndex           ID = 616
-	seFIIndex         ID = 617
-	seNOIndex         ID = 618
-	seSEIndex         ID = 619
-	sehIndex          ID = 620
-	sehMZIndex        ID = 621
-	sesIndex          ID = 622
-	sesMLIndex        ID = 623
-	sgIndex           ID = 624
-	sgCFIndex         ID = 625
-	shIndex           ID = 626
-	shiIndex          ID = 627
-	shiLatnIndex      ID = 628
-	shiLatnMAIndex    ID = 629
-	shiTfngIndex      ID = 630
-	shiTfngMAIndex    ID = 631
-	siIndex           ID = 632
-	siLKIndex         ID = 633
-	skIndex           ID = 634
-	skSKIndex         ID = 635
-	slIndex           ID = 636
-	slSIIndex         ID = 637
-	smaIndex          ID = 638
-	smiIndex          ID = 639
-	smjIndex          ID = 640
-	smnIndex          ID = 641
-	smnFIIndex        ID = 642
-	smsIndex          ID = 643
-	snIndex           ID = 644
-	snZWIndex         ID = 645
-	soIndex           ID = 646
-	soDJIndex         ID = 647
-	soETIndex         ID = 648
-	soKEIndex         ID = 649
-	soSOIndex         ID = 650
-	sqIndex           ID = 651
-	sqALIndex         ID = 652
-	sqMKIndex         ID = 653
-	sqXKIndex         ID = 654
-	srIndex           ID = 655
-	srCyrlIndex       ID = 656
-	srCyrlBAIndex     ID = 657
-	srCyrlMEIndex     ID = 658
-	srCyrlRSIndex     ID = 659
-	srCyrlXKIndex     ID = 660
-	srLatnIndex       ID = 661
-	srLatnBAIndex     ID = 662
-	srLatnMEIndex     ID = 663
-	srLatnRSIndex     ID = 664
-	srLatnXKIndex     ID = 665
-	ssIndex           ID = 666
-	ssyIndex          ID = 667
-	stIndex           ID = 668
-	svIndex           ID = 669
-	svAXIndex         ID = 670
-	svFIIndex         ID = 671
-	svSEIndex         ID = 672
-	swIndex           ID = 673
-	swCDIndex         ID = 674
-	swKEIndex         ID = 675
-	swTZIndex         ID = 676
-	swUGIndex         ID = 677
-	syrIndex          ID = 678
-	taIndex           ID = 679
-	taINIndex         ID = 680
-	taLKIndex         ID = 681
-	taMYIndex         ID = 682
-	taSGIndex         ID = 683
-	teIndex           ID = 684
-	teINIndex         ID = 685
-	teoIndex          ID = 686
-	teoKEIndex        ID = 687
-	teoUGIndex        ID = 688
-	tgIndex           ID = 689
-	tgTJIndex         ID = 690
-	thIndex           ID = 691
-	thTHIndex         ID = 692
-	tiIndex           ID = 693
-	tiERIndex         ID = 694
-	tiETIndex         ID = 695
-	tigIndex          ID = 696
-	tkIndex           ID = 697
-	tkTMIndex         ID = 698
-	tlIndex           ID = 699
-	tnIndex           ID = 700
-	toIndex           ID = 701
-	toTOIndex         ID = 702
-	trIndex           ID = 703
-	trCYIndex         ID = 704
-	trTRIndex         ID = 705
-	tsIndex           ID = 706
-	ttIndex           ID = 707
-	ttRUIndex         ID = 708
-	twqIndex          ID = 709
-	twqNEIndex        ID = 710
-	tzmIndex          ID = 711
-	tzmMAIndex        ID = 712
-	ugIndex           ID = 713
-	ugCNIndex         ID = 714
-	ukIndex           ID = 715
-	ukUAIndex         ID = 716
-	urIndex           ID = 717
-	urINIndex         ID = 718
-	urPKIndex         ID = 719
-	uzIndex           ID = 720
-	uzArabIndex       ID = 721
-	uzArabAFIndex     ID = 722
-	uzCyrlIndex       ID = 723
-	uzCyrlUZIndex     ID = 724
-	uzLatnIndex       ID = 725
-	uzLatnUZIndex     ID = 726
-	vaiIndex          ID = 727
-	vaiLatnIndex      ID = 728
-	vaiLatnLRIndex    ID = 729
-	vaiVaiiIndex      ID = 730
-	vaiVaiiLRIndex    ID = 731
-	veIndex           ID = 732
-	viIndex           ID = 733
-	viVNIndex         ID = 734
-	voIndex           ID = 735
-	vo001Index        ID = 736
-	vunIndex          ID = 737
-	vunTZIndex        ID = 738
-	waIndex           ID = 739
-	waeIndex          ID = 740
-	waeCHIndex        ID = 741
-	woIndex           ID = 742
-	woSNIndex         ID = 743
-	xhIndex           ID = 744
-	xogIndex          ID = 745
-	xogUGIndex        ID = 746
-	yavIndex          ID = 747
-	yavCMIndex        ID = 748
-	yiIndex           ID = 749
-	yi001Index        ID = 750
-	yoIndex           ID = 751
-	yoBJIndex         ID = 752
-	yoNGIndex         ID = 753
-	yueIndex          ID = 754
-	yueHansIndex      ID = 755
-	yueHansCNIndex    ID = 756
-	yueHantIndex      ID = 757
-	yueHantHKIndex    ID = 758
-	zghIndex          ID = 759
-	zghMAIndex        ID = 760
-	zhIndex           ID = 761
-	zhHansIndex       ID = 762
-	zhHansCNIndex     ID = 763
-	zhHansHKIndex     ID = 764
-	zhHansMOIndex     ID = 765
-	zhHansSGIndex     ID = 766
-	zhHantIndex       ID = 767
-	zhHantHKIndex     ID = 768
-	zhHantMOIndex     ID = 769
-	zhHantTWIndex     ID = 770
-	zuIndex           ID = 771
-	zuZAIndex         ID = 772
-	caESvalenciaIndex ID = 773
-	enUSuvaposixIndex ID = 774
-)
-
-var coreTags = []language.CompactCoreInfo{ // 773 elements
-	// Entry 0 - 1F
-	0x00000000, 0x01600000, 0x016000d2, 0x01600161,
-	0x01c00000, 0x01c00052, 0x02100000, 0x02100080,
-	0x02700000, 0x0270006f, 0x03a00000, 0x03a00001,
-	0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067,
-	0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097,
-	0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac,
-	0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9,
-	0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108,
-	// Entry 20 - 3F
-	0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c,
-	0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000,
-	0x04300000, 0x04300099, 0x04400000, 0x0440012f,
-	0x04800000, 0x0480006e, 0x05800000, 0x0581f000,
-	0x0581f032, 0x05857000, 0x05857032, 0x05e00000,
-	0x05e00052, 0x07100000, 0x07100047, 0x07500000,
-	0x07500162, 0x07900000, 0x0790012f, 0x07e00000,
-	0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3,
-	// Entry 40 - 5F
-	0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000,
-	0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078,
-	0x0b500000, 0x0b500099, 0x0b700000, 0x0b71f000,
-	0x0b71f033, 0x0b757000, 0x0b757033, 0x0d700000,
-	0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e,
-	0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000,
-	0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000,
-	0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c,
-	// Entry 60 - 7F
-	0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106,
-	0x10000000, 0x1000007b, 0x10100000, 0x10100063,
-	0x10100082, 0x10800000, 0x108000a4, 0x10d00000,
-	0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060,
-	0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000,
-	0x117000d4, 0x11f00000, 0x11f00060, 0x12400000,
-	0x12400052, 0x12800000, 0x12b00000, 0x12b00114,
-	0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4,
-	// Entry 80 - 9F
-	0x13000000, 0x13000080, 0x13000122, 0x13600000,
-	0x1360005d, 0x13600087, 0x13900000, 0x13900001,
-	0x1390001a, 0x13900025, 0x13900026, 0x1390002d,
-	0x1390002e, 0x1390002f, 0x13900034, 0x13900036,
-	0x1390003a, 0x1390003d, 0x13900042, 0x13900046,
-	0x13900048, 0x13900049, 0x1390004a, 0x1390004e,
-	0x13900050, 0x13900052, 0x1390005c, 0x1390005d,
-	0x13900060, 0x13900061, 0x13900063, 0x13900064,
-	// Entry A0 - BF
-	0x1390006d, 0x13900072, 0x13900073, 0x13900074,
-	0x13900075, 0x1390007b, 0x1390007c, 0x1390007f,
-	0x13900080, 0x13900081, 0x13900083, 0x1390008a,
-	0x1390008c, 0x1390008d, 0x13900096, 0x13900097,
-	0x13900098, 0x13900099, 0x1390009a, 0x1390009f,
-	0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9,
-	0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5,
-	0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7,
-	// Entry C0 - DF
-	0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce,
-	0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6,
-	0x139000d9, 0x139000dd, 0x139000df, 0x139000e0,
-	0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb,
-	0x139000ec, 0x139000f0, 0x13900107, 0x13900109,
-	0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d,
-	0x1390010e, 0x1390010f, 0x13900112, 0x13900117,
-	0x1390011b, 0x1390011d, 0x1390011f, 0x13900125,
-	// Entry E0 - FF
-	0x13900129, 0x1390012c, 0x1390012d, 0x1390012f,
-	0x13900131, 0x13900133, 0x13900135, 0x13900139,
-	0x1390013c, 0x1390013d, 0x1390013f, 0x13900142,
-	0x13900161, 0x13900162, 0x13900164, 0x13c00000,
-	0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c,
-	0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051,
-	0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065,
-	0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086,
-	// Entry 100 - 11F
-	0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf,
-	0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7,
-	0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135,
-	0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a,
-	0x14500000, 0x1450006e, 0x14600000, 0x14600052,
-	0x14800000, 0x14800024, 0x1480009c, 0x14e00000,
-	0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114,
-	0x15100000, 0x15100072, 0x15300000, 0x153000e7,
-	// Entry 120 - 13F
-	0x15800000, 0x15800063, 0x15800076, 0x15e00000,
-	0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b,
-	0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c,
-	0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052,
-	0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a,
-	0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086,
-	0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba,
-	0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3,
-	// Entry 140 - 15F
-	0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3,
-	0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102,
-	0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c,
-	0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f,
-	0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e,
-	0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096,
-	0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e,
-	0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2,
-	// Entry 160 - 17F
-	0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000,
-	0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000,
-	0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000,
-	0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000,
-	0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090,
-	0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092,
-	0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095,
-	0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053,
-	// Entry 180 - 19F
-	0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d,
-	0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113,
-	0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000,
-	0x200000a2, 0x20300000, 0x20700000, 0x20700052,
-	0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000,
-	0x20f00000, 0x21000000, 0x2100007d, 0x21200000,
-	0x21200067, 0x21600000, 0x21700000, 0x217000a4,
-	0x21f00000, 0x22300000, 0x2230012f, 0x22700000,
-	// Entry 1A0 - 1BF
-	0x2270005a, 0x23400000, 0x234000c3, 0x23900000,
-	0x239000a4, 0x24200000, 0x242000ae, 0x24400000,
-	0x24400052, 0x24500000, 0x24500082, 0x24600000,
-	0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000,
-	0x25100099, 0x25400000, 0x254000aa, 0x254000ab,
-	0x25600000, 0x25600099, 0x26a00000, 0x26a00099,
-	0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052,
-	0x26e00000, 0x26e00060, 0x27400000, 0x28100000,
-	// Entry 1C0 - 1DF
-	0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000,
-	0x2910012f, 0x29500000, 0x295000b7, 0x2a300000,
-	0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000,
-	0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d,
-	0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b,
-	0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000,
-	0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000,
-	0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000,
-	// Entry 1E0 - 1FF
-	0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4,
-	0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf,
-	0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052,
-	0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099,
-	0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000,
-	0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0,
-	0x31f0010d, 0x32000000, 0x320000cb, 0x32500000,
-	0x32500052, 0x33100000, 0x331000c4, 0x33a00000,
-	// Entry 200 - 21F
-	0x33a0009c, 0x34100000, 0x34500000, 0x345000d2,
-	0x34700000, 0x347000da, 0x34700110, 0x34e00000,
-	0x34e00164, 0x35000000, 0x35000060, 0x350000d9,
-	0x35100000, 0x35100099, 0x351000db, 0x36700000,
-	0x36700030, 0x36700036, 0x36700040, 0x3670005b,
-	0x367000d9, 0x36700116, 0x3670011b, 0x36800000,
-	0x36800052, 0x36a00000, 0x36a000da, 0x36c00000,
-	0x36c00052, 0x36f00000, 0x37500000, 0x37600000,
-	// Entry 220 - 23F
-	0x37a00000, 0x38000000, 0x38000117, 0x38700000,
-	0x38900000, 0x38900131, 0x39000000, 0x3900006f,
-	0x390000a4, 0x39500000, 0x39500099, 0x39800000,
-	0x3980007d, 0x39800106, 0x39d00000, 0x39d05000,
-	0x39d050e8, 0x39d33000, 0x39d33099, 0x3a100000,
-	0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001,
-	0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a,
-	0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086,
-	// Entry 240 - 25F
-	0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1,
-	0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000,
-	0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000,
-	0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000,
-	0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f,
-	0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae,
-	0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000,
-	0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000,
-	// Entry 260 - 27F
-	0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000,
-	0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000,
-	0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c,
-	0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3,
-	0x40200000, 0x4020004c, 0x40700000, 0x40800000,
-	0x40857000, 0x408570ba, 0x408dc000, 0x408dc0ba,
-	0x40c00000, 0x40c000b3, 0x41200000, 0x41200111,
-	0x41600000, 0x4160010f, 0x41c00000, 0x41d00000,
-	// Entry 280 - 29F
-	0x41e00000, 0x41f00000, 0x41f00072, 0x42200000,
-	0x42300000, 0x42300164, 0x42900000, 0x42900062,
-	0x4290006f, 0x429000a4, 0x42900115, 0x43100000,
-	0x43100027, 0x431000c2, 0x4310014d, 0x43200000,
-	0x4321f000, 0x4321f033, 0x4321f0bd, 0x4321f105,
-	0x4321f14d, 0x43257000, 0x43257033, 0x432570bd,
-	0x43257105, 0x4325714d, 0x43700000, 0x43a00000,
-	0x43b00000, 0x44400000, 0x44400031, 0x44400072,
-	// Entry 2A0 - 2BF
-	0x4440010c, 0x44500000, 0x4450004b, 0x445000a4,
-	0x4450012f, 0x44500131, 0x44e00000, 0x45000000,
-	0x45000099, 0x450000b3, 0x450000d0, 0x4500010d,
-	0x46100000, 0x46100099, 0x46400000, 0x464000a4,
-	0x46400131, 0x46700000, 0x46700124, 0x46b00000,
-	0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f,
-	0x47100000, 0x47600000, 0x47600127, 0x47a00000,
-	0x48000000, 0x48200000, 0x48200129, 0x48a00000,
-	// Entry 2C0 - 2DF
-	0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000,
-	0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000,
-	0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000,
-	0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8,
-	0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc1f000,
-	0x4bc1f137, 0x4bc57000, 0x4bc57137, 0x4be00000,
-	0x4be57000, 0x4be570b4, 0x4bee3000, 0x4bee30b4,
-	0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000,
-	// Entry 2E0 - 2FF
-	0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000,
-	0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114,
-	0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000,
-	0x50900052, 0x51200000, 0x51200001, 0x51800000,
-	0x5180003b, 0x518000d6, 0x51f00000, 0x51f38000,
-	0x51f38053, 0x51f39000, 0x51f3908d, 0x52800000,
-	0x528000ba, 0x52900000, 0x52938000, 0x52938053,
-	0x5293808d, 0x529380c6, 0x5293810d, 0x52939000,
-	// Entry 300 - 31F
-	0x5293908d, 0x529390c6, 0x5293912e, 0x52f00000,
-	0x52f00161,
-} // Size: 3116 bytes
-
-const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix"
-
-// Total table size 3147 bytes (3KiB); checksum: F4E57D15
diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go
deleted file mode 100644
index ca135d29..00000000
--- a/vendor/golang.org/x/text/internal/language/compact/tags.go
+++ /dev/null
@@ -1,91 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package compact
-
-var (
-	und = Tag{}
-
-	Und Tag = Tag{}
-
-	Afrikaans            Tag = Tag{language: afIndex, locale: afIndex}
-	Amharic              Tag = Tag{language: amIndex, locale: amIndex}
-	Arabic               Tag = Tag{language: arIndex, locale: arIndex}
-	ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index}
-	Azerbaijani          Tag = Tag{language: azIndex, locale: azIndex}
-	Bulgarian            Tag = Tag{language: bgIndex, locale: bgIndex}
-	Bengali              Tag = Tag{language: bnIndex, locale: bnIndex}
-	Catalan              Tag = Tag{language: caIndex, locale: caIndex}
-	Czech                Tag = Tag{language: csIndex, locale: csIndex}
-	Danish               Tag = Tag{language: daIndex, locale: daIndex}
-	German               Tag = Tag{language: deIndex, locale: deIndex}
-	Greek                Tag = Tag{language: elIndex, locale: elIndex}
-	English              Tag = Tag{language: enIndex, locale: enIndex}
-	AmericanEnglish      Tag = Tag{language: enUSIndex, locale: enUSIndex}
-	BritishEnglish       Tag = Tag{language: enGBIndex, locale: enGBIndex}
-	Spanish              Tag = Tag{language: esIndex, locale: esIndex}
-	EuropeanSpanish      Tag = Tag{language: esESIndex, locale: esESIndex}
-	LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index}
-	Estonian             Tag = Tag{language: etIndex, locale: etIndex}
-	Persian              Tag = Tag{language: faIndex, locale: faIndex}
-	Finnish              Tag = Tag{language: fiIndex, locale: fiIndex}
-	Filipino             Tag = Tag{language: filIndex, locale: filIndex}
-	French               Tag = Tag{language: frIndex, locale: frIndex}
-	CanadianFrench       Tag = Tag{language: frCAIndex, locale: frCAIndex}
-	Gujarati             Tag = Tag{language: guIndex, locale: guIndex}
-	Hebrew               Tag = Tag{language: heIndex, locale: heIndex}
-	Hindi                Tag = Tag{language: hiIndex, locale: hiIndex}
-	Croatian             Tag = Tag{language: hrIndex, locale: hrIndex}
-	Hungarian            Tag = Tag{language: huIndex, locale: huIndex}
-	Armenian             Tag = Tag{language: hyIndex, locale: hyIndex}
-	Indonesian           Tag = Tag{language: idIndex, locale: idIndex}
-	Icelandic            Tag = Tag{language: isIndex, locale: isIndex}
-	Italian              Tag = Tag{language: itIndex, locale: itIndex}
-	Japanese             Tag = Tag{language: jaIndex, locale: jaIndex}
-	Georgian             Tag = Tag{language: kaIndex, locale: kaIndex}
-	Kazakh               Tag = Tag{language: kkIndex, locale: kkIndex}
-	Khmer                Tag = Tag{language: kmIndex, locale: kmIndex}
-	Kannada              Tag = Tag{language: knIndex, locale: knIndex}
-	Korean               Tag = Tag{language: koIndex, locale: koIndex}
-	Kirghiz              Tag = Tag{language: kyIndex, locale: kyIndex}
-	Lao                  Tag = Tag{language: loIndex, locale: loIndex}
-	Lithuanian           Tag = Tag{language: ltIndex, locale: ltIndex}
-	Latvian              Tag = Tag{language: lvIndex, locale: lvIndex}
-	Macedonian           Tag = Tag{language: mkIndex, locale: mkIndex}
-	Malayalam            Tag = Tag{language: mlIndex, locale: mlIndex}
-	Mongolian            Tag = Tag{language: mnIndex, locale: mnIndex}
-	Marathi              Tag = Tag{language: mrIndex, locale: mrIndex}
-	Malay                Tag = Tag{language: msIndex, locale: msIndex}
-	Burmese              Tag = Tag{language: myIndex, locale: myIndex}
-	Nepali               Tag = Tag{language: neIndex, locale: neIndex}
-	Dutch                Tag = Tag{language: nlIndex, locale: nlIndex}
-	Norwegian            Tag = Tag{language: noIndex, locale: noIndex}
-	Punjabi              Tag = Tag{language: paIndex, locale: paIndex}
-	Polish               Tag = Tag{language: plIndex, locale: plIndex}
-	Portuguese           Tag = Tag{language: ptIndex, locale: ptIndex}
-	BrazilianPortuguese  Tag = Tag{language: ptBRIndex, locale: ptBRIndex}
-	EuropeanPortuguese   Tag = Tag{language: ptPTIndex, locale: ptPTIndex}
-	Romanian             Tag = Tag{language: roIndex, locale: roIndex}
-	Russian              Tag = Tag{language: ruIndex, locale: ruIndex}
-	Sinhala              Tag = Tag{language: siIndex, locale: siIndex}
-	Slovak               Tag = Tag{language: skIndex, locale: skIndex}
-	Slovenian            Tag = Tag{language: slIndex, locale: slIndex}
-	Albanian             Tag = Tag{language: sqIndex, locale: sqIndex}
-	Serbian              Tag = Tag{language: srIndex, locale: srIndex}
-	SerbianLatin         Tag = Tag{language: srLatnIndex, locale: srLatnIndex}
-	Swedish              Tag = Tag{language: svIndex, locale: svIndex}
-	Swahili              Tag = Tag{language: swIndex, locale: swIndex}
-	Tamil                Tag = Tag{language: taIndex, locale: taIndex}
-	Telugu               Tag = Tag{language: teIndex, locale: teIndex}
-	Thai                 Tag = Tag{language: thIndex, locale: thIndex}
-	Turkish              Tag = Tag{language: trIndex, locale: trIndex}
-	Ukrainian            Tag = Tag{language: ukIndex, locale: ukIndex}
-	Urdu                 Tag = Tag{language: urIndex, locale: urIndex}
-	Uzbek                Tag = Tag{language: uzIndex, locale: uzIndex}
-	Vietnamese           Tag = Tag{language: viIndex, locale: viIndex}
-	Chinese              Tag = Tag{language: zhIndex, locale: zhIndex}
-	SimplifiedChinese    Tag = Tag{language: zhHansIndex, locale: zhHansIndex}
-	TraditionalChinese   Tag = Tag{language: zhHantIndex, locale: zhHantIndex}
-	Zulu                 Tag = Tag{language: zuIndex, locale: zuIndex}
-)
diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go
deleted file mode 100644
index 4ae78e0f..00000000
--- a/vendor/golang.org/x/text/internal/language/compose.go
+++ /dev/null
@@ -1,167 +0,0 @@
-// Copyright 2018 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import (
-	"sort"
-	"strings"
-)
-
-// A Builder allows constructing a Tag from individual components.
-// Its main user is Compose in the top-level language package.
-type Builder struct {
-	Tag Tag
-
-	private    string // the x extension
-	variants   []string
-	extensions []string
-}
-
-// Make returns a new Tag from the current settings.
-func (b *Builder) Make() Tag {
-	t := b.Tag
-
-	if len(b.extensions) > 0 || len(b.variants) > 0 {
-		sort.Sort(sortVariants(b.variants))
-		sort.Strings(b.extensions)
-
-		if b.private != "" {
-			b.extensions = append(b.extensions, b.private)
-		}
-		n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...)
-		buf := make([]byte, n)
-		p := t.genCoreBytes(buf)
-		t.pVariant = byte(p)
-		p += appendTokens(buf[p:], b.variants...)
-		t.pExt = uint16(p)
-		p += appendTokens(buf[p:], b.extensions...)
-		t.str = string(buf[:p])
-		// We may not always need to remake the string, but when or when not
-		// to do so is rather tricky.
-		scan := makeScanner(buf[:p])
-		t, _ = parse(&scan, "")
-		return t
-
-	} else if b.private != "" {
-		t.str = b.private
-		t.RemakeString()
-	}
-	return t
-}
-
-// SetTag copies all the settings from a given Tag. Any previously set values
-// are discarded.
-func (b *Builder) SetTag(t Tag) {
-	b.Tag.LangID = t.LangID
-	b.Tag.RegionID = t.RegionID
-	b.Tag.ScriptID = t.ScriptID
-	// TODO: optimize
-	b.variants = b.variants[:0]
-	if variants := t.Variants(); variants != "" {
-		for _, vr := range strings.Split(variants[1:], "-") {
-			b.variants = append(b.variants, vr)
-		}
-	}
-	b.extensions, b.private = b.extensions[:0], ""
-	for _, e := range t.Extensions() {
-		b.AddExt(e)
-	}
-}
-
-// AddExt adds extension e to the tag. e must be a valid extension as returned
-// by Tag.Extension. If the extension already exists, it will be discarded,
-// except for a -u extension, where non-existing key-type pairs will added.
-func (b *Builder) AddExt(e string) {
-	if e[0] == 'x' {
-		if b.private == "" {
-			b.private = e
-		}
-		return
-	}
-	for i, s := range b.extensions {
-		if s[0] == e[0] {
-			if e[0] == 'u' {
-				b.extensions[i] += e[1:]
-			}
-			return
-		}
-	}
-	b.extensions = append(b.extensions, e)
-}
-
-// SetExt sets the extension e to the tag. e must be a valid extension as
-// returned by Tag.Extension. If the extension already exists, it will be
-// overwritten, except for a -u extension, where the individual key-type pairs
-// will be set.
-func (b *Builder) SetExt(e string) {
-	if e[0] == 'x' {
-		b.private = e
-		return
-	}
-	for i, s := range b.extensions {
-		if s[0] == e[0] {
-			if e[0] == 'u' {
-				b.extensions[i] = e + s[1:]
-			} else {
-				b.extensions[i] = e
-			}
-			return
-		}
-	}
-	b.extensions = append(b.extensions, e)
-}
-
-// AddVariant adds any number of variants.
-func (b *Builder) AddVariant(v ...string) {
-	for _, v := range v {
-		if v != "" {
-			b.variants = append(b.variants, v)
-		}
-	}
-}
-
-// ClearVariants removes any variants previously added, including those
-// copied from a Tag in SetTag.
-func (b *Builder) ClearVariants() {
-	b.variants = b.variants[:0]
-}
-
-// ClearExtensions removes any extensions previously added, including those
-// copied from a Tag in SetTag.
-func (b *Builder) ClearExtensions() {
-	b.private = ""
-	b.extensions = b.extensions[:0]
-}
-
-func tokenLen(token ...string) (n int) {
-	for _, t := range token {
-		n += len(t) + 1
-	}
-	return
-}
-
-func appendTokens(b []byte, token ...string) int {
-	p := 0
-	for _, t := range token {
-		b[p] = '-'
-		copy(b[p+1:], t)
-		p += 1 + len(t)
-	}
-	return p
-}
-
-type sortVariants []string
-
-func (s sortVariants) Len() int {
-	return len(s)
-}
-
-func (s sortVariants) Swap(i, j int) {
-	s[j], s[i] = s[i], s[j]
-}
-
-func (s sortVariants) Less(i, j int) bool {
-	return variantIndex[s[i]] < variantIndex[s[j]]
-}
diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go
deleted file mode 100644
index 9b20b88f..00000000
--- a/vendor/golang.org/x/text/internal/language/coverage.go
+++ /dev/null
@@ -1,28 +0,0 @@
-// Copyright 2014 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-// BaseLanguages returns the list of all supported base languages. It generates
-// the list by traversing the internal structures.
-func BaseLanguages() []Language {
-	base := make([]Language, 0, NumLanguages)
-	for i := 0; i < langNoIndexOffset; i++ {
-		// We included "und" already for the value 0.
-		if i != nonCanonicalUnd {
-			base = append(base, Language(i))
-		}
-	}
-	i := langNoIndexOffset
-	for _, v := range langNoIndex {
-		for k := 0; k < 8; k++ {
-			if v&1 == 1 {
-				base = append(base, Language(i))
-			}
-			v >>= 1
-			i++
-		}
-	}
-	return base
-}
diff --git a/vendor/golang.org/x/text/internal/language/gen.go b/vendor/golang.org/x/text/internal/language/gen.go
deleted file mode 100644
index cdcc7feb..00000000
--- a/vendor/golang.org/x/text/internal/language/gen.go
+++ /dev/null
@@ -1,1520 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build ignore
-
-// Language tag table generator.
-// Data read from the web.
-
-package main
-
-import (
-	"bufio"
-	"flag"
-	"fmt"
-	"io"
-	"io/ioutil"
-	"log"
-	"math"
-	"reflect"
-	"regexp"
-	"sort"
-	"strconv"
-	"strings"
-
-	"golang.org/x/text/internal/gen"
-	"golang.org/x/text/internal/tag"
-	"golang.org/x/text/unicode/cldr"
-)
-
-var (
-	test = flag.Bool("test",
-		false,
-		"test existing tables; can be used to compare web data with package data.")
-	outputFile = flag.String("output",
-		"tables.go",
-		"output file for generated tables")
-)
-
-var comment = []string{
-	`
-lang holds an alphabetically sorted list of ISO-639 language identifiers.
-All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
-For 2-byte language identifiers, the two successive bytes have the following meaning:
-    - if the first letter of the 2- and 3-letter ISO codes are the same:
-      the second and third letter of the 3-letter ISO code.
-    - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
-For 3-byte language identifiers the 4th byte is 0.`,
-	`
-langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
-in lookup tables. The language ids for these language codes are derived directly
-from the letters and are not consecutive.`,
-	`
-altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
-to 2-letter language codes that cannot be derived using the method described above.
-Each 3-letter code is followed by its 1-byte langID.`,
-	`
-altLangIndex is used to convert indexes in altLangISO3 to langIDs.`,
-	`
-AliasMap maps langIDs to their suggested replacements.`,
-	`
-script is an alphabetically sorted list of ISO 15924 codes. The index
-of the script in the string, divided by 4, is the internal scriptID.`,
-	`
-isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
-for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
-the UN.M49 codes used for groups.)`,
-	`
-regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
-Each 2-letter codes is followed by two bytes with the following meaning:
-    - [A-Z}{2}: the first letter of the 2-letter code plus these two
-                letters form the 3-letter ISO code.
-    - 0, n:     index into altRegionISO3.`,
-	`
-regionTypes defines the status of a region for various standards.`,
-	`
-m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
-codes indicating collections of regions.`,
-	`
-m49Index gives indexes into fromM49 based on the three most significant bits
-of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
-   fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
-for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
-The region code is stored in the 9 lsb of the indexed value.`,
-	`
-fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`,
-	`
-altRegionISO3 holds a list of 3-letter region codes that cannot be
-mapped to 2-letter codes using the default algorithm. This is a short list.`,
-	`
-altRegionIDs holds a list of regionIDs the positions of which match those
-of the 3-letter ISO codes in altRegionISO3.`,
-	`
-variantNumSpecialized is the number of specialized variants in variants.`,
-	`
-suppressScript is an index from langID to the dominant script for that language,
-if it exists.  If a script is given, it should be suppressed from the language tag.`,
-	`
-likelyLang is a lookup table, indexed by langID, for the most likely
-scripts and regions given incomplete information. If more entries exist for a
-given language, region and script are the index and size respectively
-of the list in likelyLangList.`,
-	`
-likelyLangList holds lists info associated with likelyLang.`,
-	`
-likelyRegion is a lookup table, indexed by regionID, for the most likely
-languages and scripts given incomplete information. If more entries exist
-for a given regionID, lang and script are the index and size respectively
-of the list in likelyRegionList.
-TODO: exclude containers and user-definable regions from the list.`,
-	`
-likelyRegionList holds lists info associated with likelyRegion.`,
-	`
-likelyScript is a lookup table, indexed by scriptID, for the most likely
-languages and regions given a script.`,
-	`
-nRegionGroups is the number of region groups.`,
-	`
-regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
-where each set holds all groupings that are directly connected in a region
-containment graph.`,
-	`
-regionInclusionBits is an array of bit vectors where every vector represents
-a set of region groupings.  These sets are used to compute the distance
-between two regions for the purpose of language matching.`,
-	`
-regionInclusionNext marks, for each entry in regionInclusionBits, the set of
-all groups that are reachable from the groups set in the respective entry.`,
-}
-
-// TODO: consider changing some of these structures to tries. This can reduce
-// memory, but may increase the need for memory allocations. This could be
-// mitigated if we can piggyback on language tags for common cases.
-
-func failOnError(e error) {
-	if e != nil {
-		log.Panic(e)
-	}
-}
-
-type setType int
-
-const (
-	Indexed setType = 1 + iota // all elements must be of same size
-	Linear
-)
-
-type stringSet struct {
-	s              []string
-	sorted, frozen bool
-
-	// We often need to update values after the creation of an index is completed.
-	// We include a convenience map for keeping track of this.
-	update map[string]string
-	typ    setType // used for checking.
-}
-
-func (ss *stringSet) clone() stringSet {
-	c := *ss
-	c.s = append([]string(nil), c.s...)
-	return c
-}
-
-func (ss *stringSet) setType(t setType) {
-	if ss.typ != t && ss.typ != 0 {
-		log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ)
-	}
-}
-
-// parse parses a whitespace-separated string and initializes ss with its
-// components.
-func (ss *stringSet) parse(s string) {
-	scan := bufio.NewScanner(strings.NewReader(s))
-	scan.Split(bufio.ScanWords)
-	for scan.Scan() {
-		ss.add(scan.Text())
-	}
-}
-
-func (ss *stringSet) assertChangeable() {
-	if ss.frozen {
-		log.Panic("attempt to modify a frozen stringSet")
-	}
-}
-
-func (ss *stringSet) add(s string) {
-	ss.assertChangeable()
-	ss.s = append(ss.s, s)
-	ss.sorted = ss.frozen
-}
-
-func (ss *stringSet) freeze() {
-	ss.compact()
-	ss.frozen = true
-}
-
-func (ss *stringSet) compact() {
-	if ss.sorted {
-		return
-	}
-	a := ss.s
-	sort.Strings(a)
-	k := 0
-	for i := 1; i < len(a); i++ {
-		if a[k] != a[i] {
-			a[k+1] = a[i]
-			k++
-		}
-	}
-	ss.s = a[:k+1]
-	ss.sorted = ss.frozen
-}
-
-type funcSorter struct {
-	fn func(a, b string) bool
-	sort.StringSlice
-}
-
-func (s funcSorter) Less(i, j int) bool {
-	return s.fn(s.StringSlice[i], s.StringSlice[j])
-}
-
-func (ss *stringSet) sortFunc(f func(a, b string) bool) {
-	ss.compact()
-	sort.Sort(funcSorter{f, sort.StringSlice(ss.s)})
-}
-
-func (ss *stringSet) remove(s string) {
-	ss.assertChangeable()
-	if i, ok := ss.find(s); ok {
-		copy(ss.s[i:], ss.s[i+1:])
-		ss.s = ss.s[:len(ss.s)-1]
-	}
-}
-
-func (ss *stringSet) replace(ol, nu string) {
-	ss.s[ss.index(ol)] = nu
-	ss.sorted = ss.frozen
-}
-
-func (ss *stringSet) index(s string) int {
-	ss.setType(Indexed)
-	i, ok := ss.find(s)
-	if !ok {
-		if i < len(ss.s) {
-			log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i])
-		}
-		log.Panicf("find: item %q is not in list", s)
-
-	}
-	return i
-}
-
-func (ss *stringSet) find(s string) (int, bool) {
-	ss.compact()
-	i := sort.SearchStrings(ss.s, s)
-	return i, i != len(ss.s) && ss.s[i] == s
-}
-
-func (ss *stringSet) slice() []string {
-	ss.compact()
-	return ss.s
-}
-
-func (ss *stringSet) updateLater(v, key string) {
-	if ss.update == nil {
-		ss.update = map[string]string{}
-	}
-	ss.update[v] = key
-}
-
-// join joins the string and ensures that all entries are of the same length.
-func (ss *stringSet) join() string {
-	ss.setType(Indexed)
-	n := len(ss.s[0])
-	for _, s := range ss.s {
-		if len(s) != n {
-			log.Panicf("join: not all entries are of the same length: %q", s)
-		}
-	}
-	ss.s = append(ss.s, strings.Repeat("\xff", n))
-	return strings.Join(ss.s, "")
-}
-
-// ianaEntry holds information for an entry in the IANA Language Subtag Repository.
-// All types use the same entry.
-// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various
-// fields.
-type ianaEntry struct {
-	typ            string
-	description    []string
-	scope          string
-	added          string
-	preferred      string
-	deprecated     string
-	suppressScript string
-	macro          string
-	prefix         []string
-}
-
-type builder struct {
-	w    *gen.CodeWriter
-	hw   io.Writer // MultiWriter for w and w.Hash
-	data *cldr.CLDR
-	supp *cldr.SupplementalData
-
-	// indices
-	locale      stringSet // common locales
-	lang        stringSet // canonical language ids (2 or 3 letter ISO codes) with data
-	langNoIndex stringSet // 3-letter ISO codes with no associated data
-	script      stringSet // 4-letter ISO codes
-	region      stringSet // 2-letter ISO or 3-digit UN M49 codes
-	variant     stringSet // 4-8-alphanumeric variant code.
-
-	// Region codes that are groups with their corresponding group IDs.
-	groups map[int]index
-
-	// langInfo
-	registry map[string]*ianaEntry
-}
-
-type index uint
-
-func newBuilder(w *gen.CodeWriter) *builder {
-	r := gen.OpenCLDRCoreZip()
-	defer r.Close()
-	d := &cldr.Decoder{}
-	data, err := d.DecodeZip(r)
-	failOnError(err)
-	b := builder{
-		w:    w,
-		hw:   io.MultiWriter(w, w.Hash),
-		data: data,
-		supp: data.Supplemental(),
-	}
-	b.parseRegistry()
-	return &b
-}
-
-func (b *builder) parseRegistry() {
-	r := gen.OpenIANAFile("assignments/language-subtag-registry")
-	defer r.Close()
-	b.registry = make(map[string]*ianaEntry)
-
-	scan := bufio.NewScanner(r)
-	scan.Split(bufio.ScanWords)
-	var record *ianaEntry
-	for more := scan.Scan(); more; {
-		key := scan.Text()
-		more = scan.Scan()
-		value := scan.Text()
-		switch key {
-		case "Type:":
-			record = &ianaEntry{typ: value}
-		case "Subtag:", "Tag:":
-			if s := strings.SplitN(value, "..", 2); len(s) > 1 {
-				for a := s[0]; a <= s[1]; a = inc(a) {
-					b.addToRegistry(a, record)
-				}
-			} else {
-				b.addToRegistry(value, record)
-			}
-		case "Suppress-Script:":
-			record.suppressScript = value
-		case "Added:":
-			record.added = value
-		case "Deprecated:":
-			record.deprecated = value
-		case "Macrolanguage:":
-			record.macro = value
-		case "Preferred-Value:":
-			record.preferred = value
-		case "Prefix:":
-			record.prefix = append(record.prefix, value)
-		case "Scope:":
-			record.scope = value
-		case "Description:":
-			buf := []byte(value)
-			for more = scan.Scan(); more; more = scan.Scan() {
-				b := scan.Bytes()
-				if b[0] == '%' || b[len(b)-1] == ':' {
-					break
-				}
-				buf = append(buf, ' ')
-				buf = append(buf, b...)
-			}
-			record.description = append(record.description, string(buf))
-			continue
-		default:
-			continue
-		}
-		more = scan.Scan()
-	}
-	if scan.Err() != nil {
-		log.Panic(scan.Err())
-	}
-}
-
-func (b *builder) addToRegistry(key string, entry *ianaEntry) {
-	if info, ok := b.registry[key]; ok {
-		if info.typ != "language" || entry.typ != "extlang" {
-			log.Fatalf("parseRegistry: tag %q already exists", key)
-		}
-	} else {
-		b.registry[key] = entry
-	}
-}
-
-var commentIndex = make(map[string]string)
-
-func init() {
-	for _, s := range comment {
-		key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0])
-		commentIndex[key] = s
-	}
-}
-
-func (b *builder) comment(name string) {
-	if s := commentIndex[name]; len(s) > 0 {
-		b.w.WriteComment(s)
-	} else {
-		fmt.Fprintln(b.w)
-	}
-}
-
-func (b *builder) pf(f string, x ...interface{}) {
-	fmt.Fprintf(b.hw, f, x...)
-	fmt.Fprint(b.hw, "\n")
-}
-
-func (b *builder) p(x ...interface{}) {
-	fmt.Fprintln(b.hw, x...)
-}
-
-func (b *builder) addSize(s int) {
-	b.w.Size += s
-	b.pf("// Size: %d bytes", s)
-}
-
-func (b *builder) writeConst(name string, x interface{}) {
-	b.comment(name)
-	b.w.WriteConst(name, x)
-}
-
-// writeConsts computes f(v) for all v in values and writes the results
-// as constants named _v to a single constant block.
-func (b *builder) writeConsts(f func(string) int, values ...string) {
-	b.pf("const (")
-	for _, v := range values {
-		b.pf("\t_%s = %v", v, f(v))
-	}
-	b.pf(")")
-}
-
-// writeType writes the type of the given value, which must be a struct.
-func (b *builder) writeType(value interface{}) {
-	b.comment(reflect.TypeOf(value).Name())
-	b.w.WriteType(value)
-}
-
-func (b *builder) writeSlice(name string, ss interface{}) {
-	b.writeSliceAddSize(name, 0, ss)
-}
-
-func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) {
-	b.comment(name)
-	b.w.Size += extraSize
-	v := reflect.ValueOf(ss)
-	t := v.Type().Elem()
-	b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len())
-
-	fmt.Fprintf(b.w, "var %s = ", name)
-	b.w.WriteArray(ss)
-	b.p()
-}
-
-type FromTo struct {
-	From, To uint16
-}
-
-func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) {
-	ss.sortFunc(func(a, b string) bool {
-		return index(a) < index(b)
-	})
-	m := []FromTo{}
-	for _, s := range ss.s {
-		m = append(m, FromTo{index(s), index(ss.update[s])})
-	}
-	b.writeSlice(name, m)
-}
-
-const base = 'z' - 'a' + 1
-
-func strToInt(s string) uint {
-	v := uint(0)
-	for i := 0; i < len(s); i++ {
-		v *= base
-		v += uint(s[i] - 'a')
-	}
-	return v
-}
-
-// converts the given integer to the original ASCII string passed to strToInt.
-// len(s) must match the number of characters obtained.
-func intToStr(v uint, s []byte) {
-	for i := len(s) - 1; i >= 0; i-- {
-		s[i] = byte(v%base) + 'a'
-		v /= base
-	}
-}
-
-func (b *builder) writeBitVector(name string, ss []string) {
-	vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8)))
-	for _, s := range ss {
-		v := strToInt(s)
-		vec[v/8] |= 1 << (v % 8)
-	}
-	b.writeSlice(name, vec)
-}
-
-// TODO: convert this type into a list or two-stage trie.
-func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) {
-	b.comment(name)
-	v := reflect.ValueOf(m)
-	sz := v.Len() * (2 + int(v.Type().Key().Size()))
-	for _, k := range m {
-		sz += len(k)
-	}
-	b.addSize(sz)
-	keys := []string{}
-	b.pf(`var %s = map[string]uint16{`, name)
-	for k := range m {
-		keys = append(keys, k)
-	}
-	sort.Strings(keys)
-	for _, k := range keys {
-		b.pf("\t%q: %v,", k, f(m[k]))
-	}
-	b.p("}")
-}
-
-func (b *builder) writeMap(name string, m interface{}) {
-	b.comment(name)
-	v := reflect.ValueOf(m)
-	sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size()))
-	b.addSize(sz)
-	f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool {
-		return strings.IndexRune("{}, ", r) != -1
-	})
-	sort.Strings(f[1:])
-	b.pf(`var %s = %s{`, name, f[0])
-	for _, kv := range f[1:] {
-		b.pf("\t%s,", kv)
-	}
-	b.p("}")
-}
-
-func (b *builder) langIndex(s string) uint16 {
-	if s == "und" {
-		return 0
-	}
-	if i, ok := b.lang.find(s); ok {
-		return uint16(i)
-	}
-	return uint16(strToInt(s)) + uint16(len(b.lang.s))
-}
-
-// inc advances the string to its lexicographical successor.
-func inc(s string) string {
-	const maxTagLength = 4
-	var buf [maxTagLength]byte
-	intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)])
-	for i := 0; i < len(s); i++ {
-		if s[i] <= 'Z' {
-			buf[i] -= 'a' - 'A'
-		}
-	}
-	return string(buf[:len(s)])
-}
-
-func (b *builder) parseIndices() {
-	meta := b.supp.Metadata
-
-	for k, v := range b.registry {
-		var ss *stringSet
-		switch v.typ {
-		case "language":
-			if len(k) == 2 || v.suppressScript != "" || v.scope == "special" {
-				b.lang.add(k)
-				continue
-			} else {
-				ss = &b.langNoIndex
-			}
-		case "region":
-			ss = &b.region
-		case "script":
-			ss = &b.script
-		case "variant":
-			ss = &b.variant
-		default:
-			continue
-		}
-		ss.add(k)
-	}
-	// Include any language for which there is data.
-	for _, lang := range b.data.Locales() {
-		if x := b.data.RawLDML(lang); false ||
-			x.LocaleDisplayNames != nil ||
-			x.Characters != nil ||
-			x.Delimiters != nil ||
-			x.Measurement != nil ||
-			x.Dates != nil ||
-			x.Numbers != nil ||
-			x.Units != nil ||
-			x.ListPatterns != nil ||
-			x.Collations != nil ||
-			x.Segmentations != nil ||
-			x.Rbnf != nil ||
-			x.Annotations != nil ||
-			x.Metadata != nil {
-
-			from := strings.Split(lang, "_")
-			if lang := from[0]; lang != "root" {
-				b.lang.add(lang)
-			}
-		}
-	}
-	// Include locales for plural rules, which uses a different structure.
-	for _, plurals := range b.data.Supplemental().Plurals {
-		for _, rules := range plurals.PluralRules {
-			for _, lang := range strings.Split(rules.Locales, " ") {
-				if lang = strings.Split(lang, "_")[0]; lang != "root" {
-					b.lang.add(lang)
-				}
-			}
-		}
-	}
-	// Include languages in likely subtags.
-	for _, m := range b.supp.LikelySubtags.LikelySubtag {
-		from := strings.Split(m.From, "_")
-		b.lang.add(from[0])
-	}
-	// Include ISO-639 alpha-3 bibliographic entries.
-	for _, a := range meta.Alias.LanguageAlias {
-		if a.Reason == "bibliographic" {
-			b.langNoIndex.add(a.Type)
-		}
-	}
-	// Include regions in territoryAlias (not all are in the IANA registry!)
-	for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
-		if len(reg.Type) == 2 {
-			b.region.add(reg.Type)
-		}
-	}
-
-	for _, s := range b.lang.s {
-		if len(s) == 3 {
-			b.langNoIndex.remove(s)
-		}
-	}
-	b.writeConst("NumLanguages", len(b.lang.slice())+len(b.langNoIndex.slice()))
-	b.writeConst("NumScripts", len(b.script.slice()))
-	b.writeConst("NumRegions", len(b.region.slice()))
-
-	// Add dummy codes at the start of each list to represent "unspecified".
-	b.lang.add("---")
-	b.script.add("----")
-	b.region.add("---")
-
-	// common locales
-	b.locale.parse(meta.DefaultContent.Locales)
-}
-
-// TODO: region inclusion data will probably not be use used in future matchers.
-
-func (b *builder) computeRegionGroups() {
-	b.groups = make(map[int]index)
-
-	// Create group indices.
-	for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID.
-		b.groups[i] = index(len(b.groups))
-	}
-	for _, g := range b.supp.TerritoryContainment.Group {
-		// Skip UN and EURO zone as they are flattening the containment
-		// relationship.
-		if g.Type == "EZ" || g.Type == "UN" {
-			continue
-		}
-		group := b.region.index(g.Type)
-		if _, ok := b.groups[group]; !ok {
-			b.groups[group] = index(len(b.groups))
-		}
-	}
-	if len(b.groups) > 64 {
-		log.Fatalf("only 64 groups supported, found %d", len(b.groups))
-	}
-	b.writeConst("nRegionGroups", len(b.groups))
-}
-
-var langConsts = []string{
-	"af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es",
-	"et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is",
-	"it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml",
-	"mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt",
-	"ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th",
-	"tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu",
-
-	// constants for grandfathered tags (if not already defined)
-	"jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu",
-	"nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn",
-}
-
-// writeLanguage generates all tables needed for language canonicalization.
-func (b *builder) writeLanguage() {
-	meta := b.supp.Metadata
-
-	b.writeConst("nonCanonicalUnd", b.lang.index("und"))
-	b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...)
-	b.writeConst("langPrivateStart", b.langIndex("qaa"))
-	b.writeConst("langPrivateEnd", b.langIndex("qtz"))
-
-	// Get language codes that need to be mapped (overlong 3-letter codes,
-	// deprecated 2-letter codes, legacy and grandfathered tags.)
-	langAliasMap := stringSet{}
-	aliasTypeMap := map[string]AliasType{}
-
-	// altLangISO3 get the alternative ISO3 names that need to be mapped.
-	altLangISO3 := stringSet{}
-	// Add dummy start to avoid the use of index 0.
-	altLangISO3.add("---")
-	altLangISO3.updateLater("---", "aa")
-
-	lang := b.lang.clone()
-	for _, a := range meta.Alias.LanguageAlias {
-		if a.Replacement == "" {
-			a.Replacement = "und"
-		}
-		// TODO: support mapping to tags
-		repl := strings.SplitN(a.Replacement, "_", 2)[0]
-		if a.Reason == "overlong" {
-			if len(a.Replacement) == 2 && len(a.Type) == 3 {
-				lang.updateLater(a.Replacement, a.Type)
-			}
-		} else if len(a.Type) <= 3 {
-			switch a.Reason {
-			case "macrolanguage":
-				aliasTypeMap[a.Type] = Macro
-			case "deprecated":
-				// handled elsewhere
-				continue
-			case "bibliographic", "legacy":
-				if a.Type == "no" {
-					continue
-				}
-				aliasTypeMap[a.Type] = Legacy
-			default:
-				log.Fatalf("new %s alias: %s", a.Reason, a.Type)
-			}
-			langAliasMap.add(a.Type)
-			langAliasMap.updateLater(a.Type, repl)
-		}
-	}
-	// Manually add the mapping of "nb" (Norwegian) to its macro language.
-	// This can be removed if CLDR adopts this change.
-	langAliasMap.add("nb")
-	langAliasMap.updateLater("nb", "no")
-	aliasTypeMap["nb"] = Macro
-
-	for k, v := range b.registry {
-		// Also add deprecated values for 3-letter ISO codes, which CLDR omits.
-		if v.typ == "language" && v.deprecated != "" && v.preferred != "" {
-			langAliasMap.add(k)
-			langAliasMap.updateLater(k, v.preferred)
-			aliasTypeMap[k] = Deprecated
-		}
-	}
-	// Fix CLDR mappings.
-	lang.updateLater("tl", "tgl")
-	lang.updateLater("sh", "hbs")
-	lang.updateLater("mo", "mol")
-	lang.updateLater("no", "nor")
-	lang.updateLater("tw", "twi")
-	lang.updateLater("nb", "nob")
-	lang.updateLater("ak", "aka")
-	lang.updateLater("bh", "bih")
-
-	// Ensure that each 2-letter code is matched with a 3-letter code.
-	for _, v := range lang.s[1:] {
-		s, ok := lang.update[v]
-		if !ok {
-			if s, ok = lang.update[langAliasMap.update[v]]; !ok {
-				continue
-			}
-			lang.update[v] = s
-		}
-		if v[0] != s[0] {
-			altLangISO3.add(s)
-			altLangISO3.updateLater(s, v)
-		}
-	}
-
-	// Complete canonicalized language tags.
-	lang.freeze()
-	for i, v := range lang.s {
-		// We can avoid these manual entries by using the IANA registry directly.
-		// Seems easier to update the list manually, as changes are rare.
-		// The panic in this loop will trigger if we miss an entry.
-		add := ""
-		if s, ok := lang.update[v]; ok {
-			if s[0] == v[0] {
-				add = s[1:]
-			} else {
-				add = string([]byte{0, byte(altLangISO3.index(s))})
-			}
-		} else if len(v) == 3 {
-			add = "\x00"
-		} else {
-			log.Panicf("no data for long form of %q", v)
-		}
-		lang.s[i] += add
-	}
-	b.writeConst("lang", tag.Index(lang.join()))
-
-	b.writeConst("langNoIndexOffset", len(b.lang.s))
-
-	// space of all valid 3-letter language identifiers.
-	b.writeBitVector("langNoIndex", b.langNoIndex.slice())
-
-	altLangIndex := []uint16{}
-	for i, s := range altLangISO3.slice() {
-		altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))})
-		if i > 0 {
-			idx := b.lang.index(altLangISO3.update[s])
-			altLangIndex = append(altLangIndex, uint16(idx))
-		}
-	}
-	b.writeConst("altLangISO3", tag.Index(altLangISO3.join()))
-	b.writeSlice("altLangIndex", altLangIndex)
-
-	b.writeSortedMap("AliasMap", &langAliasMap, b.langIndex)
-	types := make([]AliasType, len(langAliasMap.s))
-	for i, s := range langAliasMap.s {
-		types[i] = aliasTypeMap[s]
-	}
-	b.writeSlice("AliasTypes", types)
-}
-
-var scriptConsts = []string{
-	"Latn", "Hani", "Hans", "Hant", "Qaaa", "Qaai", "Qabx", "Zinh", "Zyyy",
-	"Zzzz",
-}
-
-func (b *builder) writeScript() {
-	b.writeConsts(b.script.index, scriptConsts...)
-	b.writeConst("script", tag.Index(b.script.join()))
-
-	supp := make([]uint8, len(b.lang.slice()))
-	for i, v := range b.lang.slice()[1:] {
-		if sc := b.registry[v].suppressScript; sc != "" {
-			supp[i+1] = uint8(b.script.index(sc))
-		}
-	}
-	b.writeSlice("suppressScript", supp)
-
-	// There is only one deprecated script in CLDR. This value is hard-coded.
-	// We check here if the code must be updated.
-	for _, a := range b.supp.Metadata.Alias.ScriptAlias {
-		if a.Type != "Qaai" {
-			log.Panicf("unexpected deprecated stript %q", a.Type)
-		}
-	}
-}
-
-func parseM49(s string) int16 {
-	if len(s) == 0 {
-		return 0
-	}
-	v, err := strconv.ParseUint(s, 10, 10)
-	failOnError(err)
-	return int16(v)
-}
-
-var regionConsts = []string{
-	"001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US",
-	"ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo.
-}
-
-func (b *builder) writeRegion() {
-	b.writeConsts(b.region.index, regionConsts...)
-
-	isoOffset := b.region.index("AA")
-	m49map := make([]int16, len(b.region.slice()))
-	fromM49map := make(map[int16]int)
-	altRegionISO3 := ""
-	altRegionIDs := []uint16{}
-
-	b.writeConst("isoRegionOffset", isoOffset)
-
-	// 2-letter region lookup and mapping to numeric codes.
-	regionISO := b.region.clone()
-	regionISO.s = regionISO.s[isoOffset:]
-	regionISO.sorted = false
-
-	regionTypes := make([]byte, len(b.region.s))
-
-	// Is the region valid BCP 47?
-	for s, e := range b.registry {
-		if len(s) == 2 && s == strings.ToUpper(s) {
-			i := b.region.index(s)
-			for _, d := range e.description {
-				if strings.Contains(d, "Private use") {
-					regionTypes[i] = iso3166UserAssigned
-				}
-			}
-			regionTypes[i] |= bcp47Region
-		}
-	}
-
-	// Is the region a valid ccTLD?
-	r := gen.OpenIANAFile("domains/root/db")
-	defer r.Close()
-
-	buf, err := ioutil.ReadAll(r)
-	failOnError(err)
-	re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`)
-	for _, m := range re.FindAllSubmatch(buf, -1) {
-		i := b.region.index(strings.ToUpper(string(m[1])))
-		regionTypes[i] |= ccTLD
-	}
-
-	b.writeSlice("regionTypes", regionTypes)
-
-	iso3Set := make(map[string]int)
-	update := func(iso2, iso3 string) {
-		i := regionISO.index(iso2)
-		if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] {
-			regionISO.s[i] += iso3[1:]
-			iso3Set[iso3] = -1
-		} else {
-			if ok && j >= 0 {
-				regionISO.s[i] += string([]byte{0, byte(j)})
-			} else {
-				iso3Set[iso3] = len(altRegionISO3)
-				regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))})
-				altRegionISO3 += iso3
-				altRegionIDs = append(altRegionIDs, uint16(isoOffset+i))
-			}
-		}
-	}
-	for _, tc := range b.supp.CodeMappings.TerritoryCodes {
-		i := regionISO.index(tc.Type) + isoOffset
-		if d := m49map[i]; d != 0 {
-			log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d)
-		}
-		m49 := parseM49(tc.Numeric)
-		m49map[i] = m49
-		if r := fromM49map[m49]; r == 0 {
-			fromM49map[m49] = i
-		} else if r != i {
-			dep := b.registry[regionISO.s[r-isoOffset]].deprecated
-			if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) {
-				fromM49map[m49] = i
-			}
-		}
-	}
-	for _, ta := range b.supp.Metadata.Alias.TerritoryAlias {
-		if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 {
-			from := parseM49(ta.Type)
-			if r := fromM49map[from]; r == 0 {
-				fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset
-			}
-		}
-	}
-	for _, tc := range b.supp.CodeMappings.TerritoryCodes {
-		if len(tc.Alpha3) == 3 {
-			update(tc.Type, tc.Alpha3)
-		}
-	}
-	// This entries are not included in territoryCodes. Mostly 3-letter variants
-	// of deleted codes and an entry for QU.
-	for _, m := range []struct{ iso2, iso3 string }{
-		{"CT", "CTE"},
-		{"DY", "DHY"},
-		{"HV", "HVO"},
-		{"JT", "JTN"},
-		{"MI", "MID"},
-		{"NH", "NHB"},
-		{"NQ", "ATN"},
-		{"PC", "PCI"},
-		{"PU", "PUS"},
-		{"PZ", "PCZ"},
-		{"RH", "RHO"},
-		{"VD", "VDR"},
-		{"WK", "WAK"},
-		// These three-letter codes are used for others as well.
-		{"FQ", "ATF"},
-	} {
-		update(m.iso2, m.iso3)
-	}
-	for i, s := range regionISO.s {
-		if len(s) != 4 {
-			regionISO.s[i] = s + "  "
-		}
-	}
-	b.writeConst("regionISO", tag.Index(regionISO.join()))
-	b.writeConst("altRegionISO3", altRegionISO3)
-	b.writeSlice("altRegionIDs", altRegionIDs)
-
-	// Create list of deprecated regions.
-	// TODO: consider inserting SF -> FI. Not included by CLDR, but is the only
-	// Transitionally-reserved mapping not included.
-	regionOldMap := stringSet{}
-	// Include regions in territoryAlias (not all are in the IANA registry!)
-	for _, reg := range b.supp.Metadata.Alias.TerritoryAlias {
-		if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 {
-			regionOldMap.add(reg.Type)
-			regionOldMap.updateLater(reg.Type, reg.Replacement)
-			i, _ := regionISO.find(reg.Type)
-			j, _ := regionISO.find(reg.Replacement)
-			if k := m49map[i+isoOffset]; k == 0 {
-				m49map[i+isoOffset] = m49map[j+isoOffset]
-			}
-		}
-	}
-	b.writeSortedMap("regionOldMap", &regionOldMap, func(s string) uint16 {
-		return uint16(b.region.index(s))
-	})
-	// 3-digit region lookup, groupings.
-	for i := 1; i < isoOffset; i++ {
-		m := parseM49(b.region.s[i])
-		m49map[i] = m
-		fromM49map[m] = i
-	}
-	b.writeSlice("m49", m49map)
-
-	const (
-		searchBits = 7
-		regionBits = 9
-	)
-	if len(m49map) >= 1<<regionBits {
-		log.Fatalf("Maximum number of regions exceeded: %d > %d", len(m49map), 1<<regionBits)
-	}
-	m49Index := [9]int16{}
-	fromM49 := []uint16{}
-	m49 := []int{}
-	for k, _ := range fromM49map {
-		m49 = append(m49, int(k))
-	}
-	sort.Ints(m49)
-	for _, k := range m49[1:] {
-		val := (k & (1<<searchBits - 1)) << regionBits
-		fromM49 = append(fromM49, uint16(val|fromM49map[int16(k)]))
-		m49Index[1:][k>>searchBits] = int16(len(fromM49))
-	}
-	b.writeSlice("m49Index", m49Index)
-	b.writeSlice("fromM49", fromM49)
-}
-
-const (
-	// TODO: put these lists in regionTypes as user data? Could be used for
-	// various optimizations and refinements and could be exposed in the API.
-	iso3166Except = "AC CP DG EA EU FX IC SU TA UK"
-	iso3166Trans  = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions.
-	// DY and RH are actually not deleted, but indeterminately reserved.
-	iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD"
-)
-
-const (
-	iso3166UserAssigned = 1 << iota
-	ccTLD
-	bcp47Region
-)
-
-func find(list []string, s string) int {
-	for i, t := range list {
-		if t == s {
-			return i
-		}
-	}
-	return -1
-}
-
-// writeVariants generates per-variant information and creates a map from variant
-// name to index value. We assign index values such that sorting multiple
-// variants by index value will result in the correct order.
-// There are two types of variants: specialized and general. Specialized variants
-// are only applicable to certain language or language-script pairs. Generalized
-// variants apply to any language. Generalized variants always sort after
-// specialized variants.  We will therefore always assign a higher index value
-// to a generalized variant than any other variant. Generalized variants are
-// sorted alphabetically among themselves.
-// Specialized variants may also sort after other specialized variants. Such
-// variants will be ordered after any of the variants they may follow.
-// We assume that if a variant x is followed by a variant y, then for any prefix
-// p of x, p-x is a prefix of y. This allows us to order tags based on the
-// maximum of the length of any of its prefixes.
-// TODO: it is possible to define a set of Prefix values on variants such that
-// a total order cannot be defined to the point that this algorithm breaks.
-// In other words, we cannot guarantee the same order of variants for the
-// future using the same algorithm or for non-compliant combinations of
-// variants. For this reason, consider using simple alphabetic sorting
-// of variants and ignore Prefix restrictions altogether.
-func (b *builder) writeVariant() {
-	generalized := stringSet{}
-	specialized := stringSet{}
-	specializedExtend := stringSet{}
-	// Collate the variants by type and check assumptions.
-	for _, v := range b.variant.slice() {
-		e := b.registry[v]
-		if len(e.prefix) == 0 {
-			generalized.add(v)
-			continue
-		}
-		c := strings.Split(e.prefix[0], "-")
-		hasScriptOrRegion := false
-		if len(c) > 1 {
-			_, hasScriptOrRegion = b.script.find(c[1])
-			if !hasScriptOrRegion {
-				_, hasScriptOrRegion = b.region.find(c[1])
-
-			}
-		}
-		if len(c) == 1 || len(c) == 2 && hasScriptOrRegion {
-			// Variant is preceded by a language.
-			specialized.add(v)
-			continue
-		}
-		// Variant is preceded by another variant.
-		specializedExtend.add(v)
-		prefix := c[0] + "-"
-		if hasScriptOrRegion {
-			prefix += c[1]
-		}
-		for _, p := range e.prefix {
-			// Verify that the prefix minus the last element is a prefix of the
-			// predecessor element.
-			i := strings.LastIndex(p, "-")
-			pred := b.registry[p[i+1:]]
-			if find(pred.prefix, p[:i]) < 0 {
-				log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v)
-			}
-			// The sorting used below does not work in the general case. It works
-			// if we assume that variants that may be followed by others only have
-			// prefixes of the same length. Verify this.
-			count := strings.Count(p[:i], "-")
-			for _, q := range pred.prefix {
-				if c := strings.Count(q, "-"); c != count {
-					log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count)
-				}
-			}
-			if !strings.HasPrefix(p, prefix) {
-				log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix)
-			}
-		}
-	}
-
-	// Sort extended variants.
-	a := specializedExtend.s
-	less := func(v, w string) bool {
-		// Sort by the maximum number of elements.
-		maxCount := func(s string) (max int) {
-			for _, p := range b.registry[s].prefix {
-				if c := strings.Count(p, "-"); c > max {
-					max = c
-				}
-			}
-			return
-		}
-		if cv, cw := maxCount(v), maxCount(w); cv != cw {
-			return cv < cw
-		}
-		// Sort by name as tie breaker.
-		return v < w
-	}
-	sort.Sort(funcSorter{less, sort.StringSlice(a)})
-	specializedExtend.frozen = true
-
-	// Create index from variant name to index.
-	variantIndex := make(map[string]uint8)
-	add := func(s []string) {
-		for _, v := range s {
-			variantIndex[v] = uint8(len(variantIndex))
-		}
-	}
-	add(specialized.slice())
-	add(specializedExtend.s)
-	numSpecialized := len(variantIndex)
-	add(generalized.slice())
-	if n := len(variantIndex); n > 255 {
-		log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n)
-	}
-	b.writeMap("variantIndex", variantIndex)
-	b.writeConst("variantNumSpecialized", numSpecialized)
-}
-
-func (b *builder) writeLanguageInfo() {
-}
-
-// writeLikelyData writes tables that are used both for finding parent relations and for
-// language matching.  Each entry contains additional bits to indicate the status of the
-// data to know when it cannot be used for parent relations.
-func (b *builder) writeLikelyData() {
-	const (
-		isList = 1 << iota
-		scriptInFrom
-		regionInFrom
-	)
-	type ( // generated types
-		likelyScriptRegion struct {
-			region uint16
-			script uint8
-			flags  uint8
-		}
-		likelyLangScript struct {
-			lang   uint16
-			script uint8
-			flags  uint8
-		}
-		likelyLangRegion struct {
-			lang   uint16
-			region uint16
-		}
-		// likelyTag is used for getting likely tags for group regions, where
-		// the likely region might be a region contained in the group.
-		likelyTag struct {
-			lang   uint16
-			region uint16
-			script uint8
-		}
-	)
-	var ( // generated variables
-		likelyRegionGroup = make([]likelyTag, len(b.groups))
-		likelyLang        = make([]likelyScriptRegion, len(b.lang.s))
-		likelyRegion      = make([]likelyLangScript, len(b.region.s))
-		likelyScript      = make([]likelyLangRegion, len(b.script.s))
-		likelyLangList    = []likelyScriptRegion{}
-		likelyRegionList  = []likelyLangScript{}
-	)
-	type fromTo struct {
-		from, to []string
-	}
-	langToOther := map[int][]fromTo{}
-	regionToOther := map[int][]fromTo{}
-	for _, m := range b.supp.LikelySubtags.LikelySubtag {
-		from := strings.Split(m.From, "_")
-		to := strings.Split(m.To, "_")
-		if len(to) != 3 {
-			log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to))
-		}
-		if len(from) > 3 {
-			log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from))
-		}
-		if from[0] != to[0] && from[0] != "und" {
-			log.Fatalf("unexpected language change in expansion: %s -> %s", from, to)
-		}
-		if len(from) == 3 {
-			if from[2] != to[2] {
-				log.Fatalf("unexpected region change in expansion: %s -> %s", from, to)
-			}
-			if from[0] != "und" {
-				log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to)
-			}
-		}
-		if len(from) == 1 || from[0] != "und" {
-			id := 0
-			if from[0] != "und" {
-				id = b.lang.index(from[0])
-			}
-			langToOther[id] = append(langToOther[id], fromTo{from, to})
-		} else if len(from) == 2 && len(from[1]) == 4 {
-			sid := b.script.index(from[1])
-			likelyScript[sid].lang = uint16(b.langIndex(to[0]))
-			likelyScript[sid].region = uint16(b.region.index(to[2]))
-		} else {
-			r := b.region.index(from[len(from)-1])
-			if id, ok := b.groups[r]; ok {
-				if from[0] != "und" {
-					log.Fatalf("region changed unexpectedly: %s -> %s", from, to)
-				}
-				likelyRegionGroup[id].lang = uint16(b.langIndex(to[0]))
-				likelyRegionGroup[id].script = uint8(b.script.index(to[1]))
-				likelyRegionGroup[id].region = uint16(b.region.index(to[2]))
-			} else {
-				regionToOther[r] = append(regionToOther[r], fromTo{from, to})
-			}
-		}
-	}
-	b.writeType(likelyLangRegion{})
-	b.writeSlice("likelyScript", likelyScript)
-
-	for id := range b.lang.s {
-		list := langToOther[id]
-		if len(list) == 1 {
-			likelyLang[id].region = uint16(b.region.index(list[0].to[2]))
-			likelyLang[id].script = uint8(b.script.index(list[0].to[1]))
-		} else if len(list) > 1 {
-			likelyLang[id].flags = isList
-			likelyLang[id].region = uint16(len(likelyLangList))
-			likelyLang[id].script = uint8(len(list))
-			for _, x := range list {
-				flags := uint8(0)
-				if len(x.from) > 1 {
-					if x.from[1] == x.to[2] {
-						flags = regionInFrom
-					} else {
-						flags = scriptInFrom
-					}
-				}
-				likelyLangList = append(likelyLangList, likelyScriptRegion{
-					region: uint16(b.region.index(x.to[2])),
-					script: uint8(b.script.index(x.to[1])),
-					flags:  flags,
-				})
-			}
-		}
-	}
-	// TODO: merge suppressScript data with this table.
-	b.writeType(likelyScriptRegion{})
-	b.writeSlice("likelyLang", likelyLang)
-	b.writeSlice("likelyLangList", likelyLangList)
-
-	for id := range b.region.s {
-		list := regionToOther[id]
-		if len(list) == 1 {
-			likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0]))
-			likelyRegion[id].script = uint8(b.script.index(list[0].to[1]))
-			if len(list[0].from) > 2 {
-				likelyRegion[id].flags = scriptInFrom
-			}
-		} else if len(list) > 1 {
-			likelyRegion[id].flags = isList
-			likelyRegion[id].lang = uint16(len(likelyRegionList))
-			likelyRegion[id].script = uint8(len(list))
-			for i, x := range list {
-				if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 {
-					log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i)
-				}
-				x := likelyLangScript{
-					lang:   uint16(b.langIndex(x.to[0])),
-					script: uint8(b.script.index(x.to[1])),
-				}
-				if len(list[0].from) > 2 {
-					x.flags = scriptInFrom
-				}
-				likelyRegionList = append(likelyRegionList, x)
-			}
-		}
-	}
-	b.writeType(likelyLangScript{})
-	b.writeSlice("likelyRegion", likelyRegion)
-	b.writeSlice("likelyRegionList", likelyRegionList)
-
-	b.writeType(likelyTag{})
-	b.writeSlice("likelyRegionGroup", likelyRegionGroup)
-}
-
-func (b *builder) writeRegionInclusionData() {
-	var (
-		// mm holds for each group the set of groups with a distance of 1.
-		mm = make(map[int][]index)
-
-		// containment holds for each group the transitive closure of
-		// containment of other groups.
-		containment = make(map[index][]index)
-	)
-	for _, g := range b.supp.TerritoryContainment.Group {
-		// Skip UN and EURO zone as they are flattening the containment
-		// relationship.
-		if g.Type == "EZ" || g.Type == "UN" {
-			continue
-		}
-		group := b.region.index(g.Type)
-		groupIdx := b.groups[group]
-		for _, mem := range strings.Split(g.Contains, " ") {
-			r := b.region.index(mem)
-			mm[r] = append(mm[r], groupIdx)
-			if g, ok := b.groups[r]; ok {
-				mm[group] = append(mm[group], g)
-				containment[groupIdx] = append(containment[groupIdx], g)
-			}
-		}
-	}
-
-	regionContainment := make([]uint64, len(b.groups))
-	for _, g := range b.groups {
-		l := containment[g]
-
-		// Compute the transitive closure of containment.
-		for i := 0; i < len(l); i++ {
-			l = append(l, containment[l[i]]...)
-		}
-
-		// Compute the bitmask.
-		regionContainment[g] = 1 << g
-		for _, v := range l {
-			regionContainment[g] |= 1 << v
-		}
-	}
-	b.writeSlice("regionContainment", regionContainment)
-
-	regionInclusion := make([]uint8, len(b.region.s))
-	bvs := make(map[uint64]index)
-	// Make the first bitvector positions correspond with the groups.
-	for r, i := range b.groups {
-		bv := uint64(1 << i)
-		for _, g := range mm[r] {
-			bv |= 1 << g
-		}
-		bvs[bv] = i
-		regionInclusion[r] = uint8(bvs[bv])
-	}
-	for r := 1; r < len(b.region.s); r++ {
-		if _, ok := b.groups[r]; !ok {
-			bv := uint64(0)
-			for _, g := range mm[r] {
-				bv |= 1 << g
-			}
-			if bv == 0 {
-				// Pick the world for unspecified regions.
-				bv = 1 << b.groups[b.region.index("001")]
-			}
-			if _, ok := bvs[bv]; !ok {
-				bvs[bv] = index(len(bvs))
-			}
-			regionInclusion[r] = uint8(bvs[bv])
-		}
-	}
-	b.writeSlice("regionInclusion", regionInclusion)
-	regionInclusionBits := make([]uint64, len(bvs))
-	for k, v := range bvs {
-		regionInclusionBits[v] = uint64(k)
-	}
-	// Add bit vectors for increasingly large distances until a fixed point is reached.
-	regionInclusionNext := []uint8{}
-	for i := 0; i < len(regionInclusionBits); i++ {
-		bits := regionInclusionBits[i]
-		next := bits
-		for i := uint(0); i < uint(len(b.groups)); i++ {
-			if bits&(1<<i) != 0 {
-				next |= regionInclusionBits[i]
-			}
-		}
-		if _, ok := bvs[next]; !ok {
-			bvs[next] = index(len(bvs))
-			regionInclusionBits = append(regionInclusionBits, next)
-		}
-		regionInclusionNext = append(regionInclusionNext, uint8(bvs[next]))
-	}
-	b.writeSlice("regionInclusionBits", regionInclusionBits)
-	b.writeSlice("regionInclusionNext", regionInclusionNext)
-}
-
-type parentRel struct {
-	lang       uint16
-	script     uint8
-	maxScript  uint8
-	toRegion   uint16
-	fromRegion []uint16
-}
-
-func (b *builder) writeParents() {
-	b.writeType(parentRel{})
-
-	parents := []parentRel{}
-
-	// Construct parent overrides.
-	n := 0
-	for _, p := range b.data.Supplemental().ParentLocales.ParentLocale {
-		// Skipping non-standard scripts to root is implemented using addTags.
-		if p.Parent == "root" {
-			continue
-		}
-
-		sub := strings.Split(p.Parent, "_")
-		parent := parentRel{lang: b.langIndex(sub[0])}
-		if len(sub) == 2 {
-			// TODO: check that all undefined scripts are indeed Latn in these
-			// cases.
-			parent.maxScript = uint8(b.script.index("Latn"))
-			parent.toRegion = uint16(b.region.index(sub[1]))
-		} else {
-			parent.script = uint8(b.script.index(sub[1]))
-			parent.maxScript = parent.script
-			parent.toRegion = uint16(b.region.index(sub[2]))
-		}
-		for _, c := range strings.Split(p.Locales, " ") {
-			region := b.region.index(c[strings.LastIndex(c, "_")+1:])
-			parent.fromRegion = append(parent.fromRegion, uint16(region))
-		}
-		parents = append(parents, parent)
-		n += len(parent.fromRegion)
-	}
-	b.writeSliceAddSize("parents", n*2, parents)
-}
-
-func main() {
-	gen.Init()
-
-	gen.Repackage("gen_common.go", "common.go", "language")
-
-	w := gen.NewCodeWriter()
-	defer w.WriteGoFile("tables.go", "language")
-
-	fmt.Fprintln(w, `import "golang.org/x/text/internal/tag"`)
-
-	b := newBuilder(w)
-	gen.WriteCLDRVersion(w)
-
-	b.parseIndices()
-	b.writeType(FromTo{})
-	b.writeLanguage()
-	b.writeScript()
-	b.writeRegion()
-	b.writeVariant()
-	// TODO: b.writeLocale()
-	b.computeRegionGroups()
-	b.writeLikelyData()
-	b.writeRegionInclusionData()
-	b.writeParents()
-}
diff --git a/vendor/golang.org/x/text/internal/language/gen_common.go b/vendor/golang.org/x/text/internal/language/gen_common.go
deleted file mode 100644
index c419ceeb..00000000
--- a/vendor/golang.org/x/text/internal/language/gen_common.go
+++ /dev/null
@@ -1,20 +0,0 @@
-// Copyright 2014 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build ignore
-
-package main
-
-// This file contains code common to the maketables.go and the package code.
-
-// AliasType is the type of an alias in AliasMap.
-type AliasType int8
-
-const (
-	Deprecated AliasType = iota
-	Macro
-	Legacy
-
-	AliasTypeUnknown AliasType = -1
-)
diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go
deleted file mode 100644
index aa5f5f42..00000000
--- a/vendor/golang.org/x/text/internal/language/language.go
+++ /dev/null
@@ -1,596 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:generate go run gen.go gen_common.go -output tables.go
-
-package language // import "golang.org/x/text/internal/language"
-
-// TODO: Remove above NOTE after:
-// - verifying that tables are dropped correctly (most notably matcher tables).
-
-import (
-	"errors"
-	"fmt"
-	"strings"
-)
-
-const (
-	// maxCoreSize is the maximum size of a BCP 47 tag without variants and
-	// extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
-	maxCoreSize = 12
-
-	// max99thPercentileSize is a somewhat arbitrary buffer size that presumably
-	// is large enough to hold at least 99% of the BCP 47 tags.
-	max99thPercentileSize = 32
-
-	// maxSimpleUExtensionSize is the maximum size of a -u extension with one
-	// key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
-	maxSimpleUExtensionSize = 14
-)
-
-// Tag represents a BCP 47 language tag. It is used to specify an instance of a
-// specific language or locale. All language tag values are guaranteed to be
-// well-formed. The zero value of Tag is Und.
-type Tag struct {
-	// TODO: the following fields have the form TagTypeID. This name is chosen
-	// to allow refactoring the public package without conflicting with its
-	// Base, Script, and Region methods. Once the transition is fully completed
-	// the ID can be stripped from the name.
-
-	LangID   Language
-	RegionID Region
-	// TODO: we will soon run out of positions for ScriptID. Idea: instead of
-	// storing lang, region, and ScriptID codes, store only the compact index and
-	// have a lookup table from this code to its expansion. This greatly speeds
-	// up table lookup, speed up common variant cases.
-	// This will also immediately free up 3 extra bytes. Also, the pVariant
-	// field can now be moved to the lookup table, as the compact index uniquely
-	// determines the offset of a possible variant.
-	ScriptID Script
-	pVariant byte   // offset in str, includes preceding '-'
-	pExt     uint16 // offset of first extension, includes preceding '-'
-
-	// str is the string representation of the Tag. It will only be used if the
-	// tag has variants or extensions.
-	str string
-}
-
-// Make is a convenience wrapper for Parse that omits the error.
-// In case of an error, a sensible default is returned.
-func Make(s string) Tag {
-	t, _ := Parse(s)
-	return t
-}
-
-// Raw returns the raw base language, script and region, without making an
-// attempt to infer their values.
-// TODO: consider removing
-func (t Tag) Raw() (b Language, s Script, r Region) {
-	return t.LangID, t.ScriptID, t.RegionID
-}
-
-// equalTags compares language, script and region subtags only.
-func (t Tag) equalTags(a Tag) bool {
-	return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID
-}
-
-// IsRoot returns true if t is equal to language "und".
-func (t Tag) IsRoot() bool {
-	if int(t.pVariant) < len(t.str) {
-		return false
-	}
-	return t.equalTags(Und)
-}
-
-// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use
-// tag.
-func (t Tag) IsPrivateUse() bool {
-	return t.str != "" && t.pVariant == 0
-}
-
-// RemakeString is used to update t.str in case lang, script or region changed.
-// It is assumed that pExt and pVariant still point to the start of the
-// respective parts.
-func (t *Tag) RemakeString() {
-	if t.str == "" {
-		return
-	}
-	extra := t.str[t.pVariant:]
-	if t.pVariant > 0 {
-		extra = extra[1:]
-	}
-	if t.equalTags(Und) && strings.HasPrefix(extra, "x-") {
-		t.str = extra
-		t.pVariant = 0
-		t.pExt = 0
-		return
-	}
-	var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
-	b := buf[:t.genCoreBytes(buf[:])]
-	if extra != "" {
-		diff := len(b) - int(t.pVariant)
-		b = append(b, '-')
-		b = append(b, extra...)
-		t.pVariant = uint8(int(t.pVariant) + diff)
-		t.pExt = uint16(int(t.pExt) + diff)
-	} else {
-		t.pVariant = uint8(len(b))
-		t.pExt = uint16(len(b))
-	}
-	t.str = string(b)
-}
-
-// genCoreBytes writes a string for the base languages, script and region tags
-// to the given buffer and returns the number of bytes written. It will never
-// write more than maxCoreSize bytes.
-func (t *Tag) genCoreBytes(buf []byte) int {
-	n := t.LangID.StringToBuf(buf[:])
-	if t.ScriptID != 0 {
-		n += copy(buf[n:], "-")
-		n += copy(buf[n:], t.ScriptID.String())
-	}
-	if t.RegionID != 0 {
-		n += copy(buf[n:], "-")
-		n += copy(buf[n:], t.RegionID.String())
-	}
-	return n
-}
-
-// String returns the canonical string representation of the language tag.
-func (t Tag) String() string {
-	if t.str != "" {
-		return t.str
-	}
-	if t.ScriptID == 0 && t.RegionID == 0 {
-		return t.LangID.String()
-	}
-	buf := [maxCoreSize]byte{}
-	return string(buf[:t.genCoreBytes(buf[:])])
-}
-
-// MarshalText implements encoding.TextMarshaler.
-func (t Tag) MarshalText() (text []byte, err error) {
-	if t.str != "" {
-		text = append(text, t.str...)
-	} else if t.ScriptID == 0 && t.RegionID == 0 {
-		text = append(text, t.LangID.String()...)
-	} else {
-		buf := [maxCoreSize]byte{}
-		text = buf[:t.genCoreBytes(buf[:])]
-	}
-	return text, nil
-}
-
-// UnmarshalText implements encoding.TextUnmarshaler.
-func (t *Tag) UnmarshalText(text []byte) error {
-	tag, err := Parse(string(text))
-	*t = tag
-	return err
-}
-
-// Variants returns the part of the tag holding all variants or the empty string
-// if there are no variants defined.
-func (t Tag) Variants() string {
-	if t.pVariant == 0 {
-		return ""
-	}
-	return t.str[t.pVariant:t.pExt]
-}
-
-// VariantOrPrivateUseTags returns variants or private use tags.
-func (t Tag) VariantOrPrivateUseTags() string {
-	if t.pExt > 0 {
-		return t.str[t.pVariant:t.pExt]
-	}
-	return t.str[t.pVariant:]
-}
-
-// HasString reports whether this tag defines more than just the raw
-// components.
-func (t Tag) HasString() bool {
-	return t.str != ""
-}
-
-// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
-// specific language are substituted with fields from the parent language.
-// The parent for a language may change for newer versions of CLDR.
-func (t Tag) Parent() Tag {
-	if t.str != "" {
-		// Strip the variants and extensions.
-		b, s, r := t.Raw()
-		t = Tag{LangID: b, ScriptID: s, RegionID: r}
-		if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 {
-			base, _ := addTags(Tag{LangID: t.LangID})
-			if base.ScriptID == t.ScriptID {
-				return Tag{LangID: t.LangID}
-			}
-		}
-		return t
-	}
-	if t.LangID != 0 {
-		if t.RegionID != 0 {
-			maxScript := t.ScriptID
-			if maxScript == 0 {
-				max, _ := addTags(t)
-				maxScript = max.ScriptID
-			}
-
-			for i := range parents {
-				if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript {
-					for _, r := range parents[i].fromRegion {
-						if Region(r) == t.RegionID {
-							return Tag{
-								LangID:   t.LangID,
-								ScriptID: Script(parents[i].script),
-								RegionID: Region(parents[i].toRegion),
-							}
-						}
-					}
-				}
-			}
-
-			// Strip the script if it is the default one.
-			base, _ := addTags(Tag{LangID: t.LangID})
-			if base.ScriptID != maxScript {
-				return Tag{LangID: t.LangID, ScriptID: maxScript}
-			}
-			return Tag{LangID: t.LangID}
-		} else if t.ScriptID != 0 {
-			// The parent for an base-script pair with a non-default script is
-			// "und" instead of the base language.
-			base, _ := addTags(Tag{LangID: t.LangID})
-			if base.ScriptID != t.ScriptID {
-				return Und
-			}
-			return Tag{LangID: t.LangID}
-		}
-	}
-	return Und
-}
-
-// ParseExtension parses s as an extension and returns it on success.
-func ParseExtension(s string) (ext string, err error) {
-	scan := makeScannerString(s)
-	var end int
-	if n := len(scan.token); n != 1 {
-		return "", ErrSyntax
-	}
-	scan.toLower(0, len(scan.b))
-	end = parseExtension(&scan)
-	if end != len(s) {
-		return "", ErrSyntax
-	}
-	return string(scan.b), nil
-}
-
-// HasVariants reports whether t has variants.
-func (t Tag) HasVariants() bool {
-	return uint16(t.pVariant) < t.pExt
-}
-
-// HasExtensions reports whether t has extensions.
-func (t Tag) HasExtensions() bool {
-	return int(t.pExt) < len(t.str)
-}
-
-// Extension returns the extension of type x for tag t. It will return
-// false for ok if t does not have the requested extension. The returned
-// extension will be invalid in this case.
-func (t Tag) Extension(x byte) (ext string, ok bool) {
-	for i := int(t.pExt); i < len(t.str)-1; {
-		var ext string
-		i, ext = getExtension(t.str, i)
-		if ext[0] == x {
-			return ext, true
-		}
-	}
-	return "", false
-}
-
-// Extensions returns all extensions of t.
-func (t Tag) Extensions() []string {
-	e := []string{}
-	for i := int(t.pExt); i < len(t.str)-1; {
-		var ext string
-		i, ext = getExtension(t.str, i)
-		e = append(e, ext)
-	}
-	return e
-}
-
-// TypeForKey returns the type associated with the given key, where key and type
-// are of the allowed values defined for the Unicode locale extension ('u') in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-// TypeForKey will traverse the inheritance chain to get the correct value.
-func (t Tag) TypeForKey(key string) string {
-	if start, end, _ := t.findTypeForKey(key); end != start {
-		return t.str[start:end]
-	}
-	return ""
-}
-
-var (
-	errPrivateUse       = errors.New("cannot set a key on a private use tag")
-	errInvalidArguments = errors.New("invalid key or type")
-)
-
-// SetTypeForKey returns a new Tag with the key set to type, where key and type
-// are of the allowed values defined for the Unicode locale extension ('u') in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-// An empty value removes an existing pair with the same key.
-func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
-	if t.IsPrivateUse() {
-		return t, errPrivateUse
-	}
-	if len(key) != 2 {
-		return t, errInvalidArguments
-	}
-
-	// Remove the setting if value is "".
-	if value == "" {
-		start, end, _ := t.findTypeForKey(key)
-		if start != end {
-			// Remove key tag and leading '-'.
-			start -= 4
-
-			// Remove a possible empty extension.
-			if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' {
-				start -= 2
-			}
-			if start == int(t.pVariant) && end == len(t.str) {
-				t.str = ""
-				t.pVariant, t.pExt = 0, 0
-			} else {
-				t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
-			}
-		}
-		return t, nil
-	}
-
-	if len(value) < 3 || len(value) > 8 {
-		return t, errInvalidArguments
-	}
-
-	var (
-		buf    [maxCoreSize + maxSimpleUExtensionSize]byte
-		uStart int // start of the -u extension.
-	)
-
-	// Generate the tag string if needed.
-	if t.str == "" {
-		uStart = t.genCoreBytes(buf[:])
-		buf[uStart] = '-'
-		uStart++
-	}
-
-	// Create new key-type pair and parse it to verify.
-	b := buf[uStart:]
-	copy(b, "u-")
-	copy(b[2:], key)
-	b[4] = '-'
-	b = b[:5+copy(b[5:], value)]
-	scan := makeScanner(b)
-	if parseExtensions(&scan); scan.err != nil {
-		return t, scan.err
-	}
-
-	// Assemble the replacement string.
-	if t.str == "" {
-		t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
-		t.str = string(buf[:uStart+len(b)])
-	} else {
-		s := t.str
-		start, end, hasExt := t.findTypeForKey(key)
-		if start == end {
-			if hasExt {
-				b = b[2:]
-			}
-			t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:])
-		} else {
-			t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:])
-		}
-	}
-	return t, nil
-}
-
-// findKeyAndType returns the start and end position for the type corresponding
-// to key or the point at which to insert the key-value pair if the type
-// wasn't found. The hasExt return value reports whether an -u extension was present.
-// Note: the extensions are typically very small and are likely to contain
-// only one key-type pair.
-func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) {
-	p := int(t.pExt)
-	if len(key) != 2 || p == len(t.str) || p == 0 {
-		return p, p, false
-	}
-	s := t.str
-
-	// Find the correct extension.
-	for p++; s[p] != 'u'; p++ {
-		if s[p] > 'u' {
-			p--
-			return p, p, false
-		}
-		if p = nextExtension(s, p); p == len(s) {
-			return len(s), len(s), false
-		}
-	}
-	// Proceed to the hyphen following the extension name.
-	p++
-
-	// curKey is the key currently being processed.
-	curKey := ""
-
-	// Iterate over keys until we get the end of a section.
-	for {
-		// p points to the hyphen preceding the current token.
-		if p3 := p + 3; s[p3] == '-' {
-			// Found a key.
-			// Check whether we just processed the key that was requested.
-			if curKey == key {
-				return start, p, true
-			}
-			// Set to the next key and continue scanning type tokens.
-			curKey = s[p+1 : p3]
-			if curKey > key {
-				return p, p, true
-			}
-			// Start of the type token sequence.
-			start = p + 4
-			// A type is at least 3 characters long.
-			p += 7 // 4 + 3
-		} else {
-			// Attribute or type, which is at least 3 characters long.
-			p += 4
-		}
-		// p points past the third character of a type or attribute.
-		max := p + 5 // maximum length of token plus hyphen.
-		if len(s) < max {
-			max = len(s)
-		}
-		for ; p < max && s[p] != '-'; p++ {
-		}
-		// Bail if we have exhausted all tokens or if the next token starts
-		// a new extension.
-		if p == len(s) || s[p+2] == '-' {
-			if curKey == key {
-				return start, p, true
-			}
-			return p, p, true
-		}
-	}
-}
-
-// ParseBase parses a 2- or 3-letter ISO 639 code.
-// It returns a ValueError if s is a well-formed but unknown language identifier
-// or another error if another error occurred.
-func ParseBase(s string) (Language, error) {
-	if n := len(s); n < 2 || 3 < n {
-		return 0, ErrSyntax
-	}
-	var buf [3]byte
-	return getLangID(buf[:copy(buf[:], s)])
-}
-
-// ParseScript parses a 4-letter ISO 15924 code.
-// It returns a ValueError if s is a well-formed but unknown script identifier
-// or another error if another error occurred.
-func ParseScript(s string) (Script, error) {
-	if len(s) != 4 {
-		return 0, ErrSyntax
-	}
-	var buf [4]byte
-	return getScriptID(script, buf[:copy(buf[:], s)])
-}
-
-// EncodeM49 returns the Region for the given UN M.49 code.
-// It returns an error if r is not a valid code.
-func EncodeM49(r int) (Region, error) {
-	return getRegionM49(r)
-}
-
-// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code.
-// It returns a ValueError if s is a well-formed but unknown region identifier
-// or another error if another error occurred.
-func ParseRegion(s string) (Region, error) {
-	if n := len(s); n < 2 || 3 < n {
-		return 0, ErrSyntax
-	}
-	var buf [3]byte
-	return getRegionID(buf[:copy(buf[:], s)])
-}
-
-// IsCountry returns whether this region is a country or autonomous area. This
-// includes non-standard definitions from CLDR.
-func (r Region) IsCountry() bool {
-	if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK {
-		return false
-	}
-	return true
-}
-
-// IsGroup returns whether this region defines a collection of regions. This
-// includes non-standard definitions from CLDR.
-func (r Region) IsGroup() bool {
-	if r == 0 {
-		return false
-	}
-	return int(regionInclusion[r]) < len(regionContainment)
-}
-
-// Contains returns whether Region c is contained by Region r. It returns true
-// if c == r.
-func (r Region) Contains(c Region) bool {
-	if r == c {
-		return true
-	}
-	g := regionInclusion[r]
-	if g >= nRegionGroups {
-		return false
-	}
-	m := regionContainment[g]
-
-	d := regionInclusion[c]
-	b := regionInclusionBits[d]
-
-	// A contained country may belong to multiple disjoint groups. Matching any
-	// of these indicates containment. If the contained region is a group, it
-	// must strictly be a subset.
-	if d >= nRegionGroups {
-		return b&m != 0
-	}
-	return b&^m == 0
-}
-
-var errNoTLD = errors.New("language: region is not a valid ccTLD")
-
-// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
-// In all other cases it returns either the region itself or an error.
-//
-// This method may return an error for a region for which there exists a
-// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The
-// region will already be canonicalized it was obtained from a Tag that was
-// obtained using any of the default methods.
-func (r Region) TLD() (Region, error) {
-	// See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
-	// difference between ISO 3166-1 and IANA ccTLD.
-	if r == _GB {
-		r = _UK
-	}
-	if (r.typ() & ccTLD) == 0 {
-		return 0, errNoTLD
-	}
-	return r, nil
-}
-
-// Canonicalize returns the region or a possible replacement if the region is
-// deprecated. It will not return a replacement for deprecated regions that
-// are split into multiple regions.
-func (r Region) Canonicalize() Region {
-	if cr := normRegion(r); cr != 0 {
-		return cr
-	}
-	return r
-}
-
-// Variant represents a registered variant of a language as defined by BCP 47.
-type Variant struct {
-	ID  uint8
-	str string
-}
-
-// ParseVariant parses and returns a Variant. An error is returned if s is not
-// a valid variant.
-func ParseVariant(s string) (Variant, error) {
-	s = strings.ToLower(s)
-	if id, ok := variantIndex[s]; ok {
-		return Variant{id, s}, nil
-	}
-	return Variant{}, NewValueError([]byte(s))
-}
-
-// String returns the string representation of the variant.
-func (v Variant) String() string {
-	return v.str
-}
diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go
deleted file mode 100644
index 6294b815..00000000
--- a/vendor/golang.org/x/text/internal/language/lookup.go
+++ /dev/null
@@ -1,412 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import (
-	"bytes"
-	"fmt"
-	"sort"
-	"strconv"
-
-	"golang.org/x/text/internal/tag"
-)
-
-// findIndex tries to find the given tag in idx and returns a standardized error
-// if it could not be found.
-func findIndex(idx tag.Index, key []byte, form string) (index int, err error) {
-	if !tag.FixCase(form, key) {
-		return 0, ErrSyntax
-	}
-	i := idx.Index(key)
-	if i == -1 {
-		return 0, NewValueError(key)
-	}
-	return i, nil
-}
-
-func searchUint(imap []uint16, key uint16) int {
-	return sort.Search(len(imap), func(i int) bool {
-		return imap[i] >= key
-	})
-}
-
-type Language uint16
-
-// getLangID returns the langID of s if s is a canonical subtag
-// or langUnknown if s is not a canonical subtag.
-func getLangID(s []byte) (Language, error) {
-	if len(s) == 2 {
-		return getLangISO2(s)
-	}
-	return getLangISO3(s)
-}
-
-// TODO language normalization as well as the AliasMaps could be moved to the
-// higher level package, but it is a bit tricky to separate the generation.
-
-func (id Language) Canonicalize() (Language, AliasType) {
-	return normLang(id)
-}
-
-// mapLang returns the mapped langID of id according to mapping m.
-func normLang(id Language) (Language, AliasType) {
-	k := sort.Search(len(AliasMap), func(i int) bool {
-		return AliasMap[i].From >= uint16(id)
-	})
-	if k < len(AliasMap) && AliasMap[k].From == uint16(id) {
-		return Language(AliasMap[k].To), AliasTypes[k]
-	}
-	return id, AliasTypeUnknown
-}
-
-// getLangISO2 returns the langID for the given 2-letter ISO language code
-// or unknownLang if this does not exist.
-func getLangISO2(s []byte) (Language, error) {
-	if !tag.FixCase("zz", s) {
-		return 0, ErrSyntax
-	}
-	if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 {
-		return Language(i), nil
-	}
-	return 0, NewValueError(s)
-}
-
-const base = 'z' - 'a' + 1
-
-func strToInt(s []byte) uint {
-	v := uint(0)
-	for i := 0; i < len(s); i++ {
-		v *= base
-		v += uint(s[i] - 'a')
-	}
-	return v
-}
-
-// converts the given integer to the original ASCII string passed to strToInt.
-// len(s) must match the number of characters obtained.
-func intToStr(v uint, s []byte) {
-	for i := len(s) - 1; i >= 0; i-- {
-		s[i] = byte(v%base) + 'a'
-		v /= base
-	}
-}
-
-// getLangISO3 returns the langID for the given 3-letter ISO language code
-// or unknownLang if this does not exist.
-func getLangISO3(s []byte) (Language, error) {
-	if tag.FixCase("und", s) {
-		// first try to match canonical 3-letter entries
-		for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) {
-			if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] {
-				// We treat "und" as special and always translate it to "unspecified".
-				// Note that ZZ and Zzzz are private use and are not treated as
-				// unspecified by default.
-				id := Language(i)
-				if id == nonCanonicalUnd {
-					return 0, nil
-				}
-				return id, nil
-			}
-		}
-		if i := altLangISO3.Index(s); i != -1 {
-			return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil
-		}
-		n := strToInt(s)
-		if langNoIndex[n/8]&(1<<(n%8)) != 0 {
-			return Language(n) + langNoIndexOffset, nil
-		}
-		// Check for non-canonical uses of ISO3.
-		for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) {
-			if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] {
-				return Language(i), nil
-			}
-		}
-		return 0, NewValueError(s)
-	}
-	return 0, ErrSyntax
-}
-
-// StringToBuf writes the string to b and returns the number of bytes
-// written.  cap(b) must be >= 3.
-func (id Language) StringToBuf(b []byte) int {
-	if id >= langNoIndexOffset {
-		intToStr(uint(id)-langNoIndexOffset, b[:3])
-		return 3
-	} else if id == 0 {
-		return copy(b, "und")
-	}
-	l := lang[id<<2:]
-	if l[3] == 0 {
-		return copy(b, l[:3])
-	}
-	return copy(b, l[:2])
-}
-
-// String returns the BCP 47 representation of the langID.
-// Use b as variable name, instead of id, to ensure the variable
-// used is consistent with that of Base in which this type is embedded.
-func (b Language) String() string {
-	if b == 0 {
-		return "und"
-	} else if b >= langNoIndexOffset {
-		b -= langNoIndexOffset
-		buf := [3]byte{}
-		intToStr(uint(b), buf[:])
-		return string(buf[:])
-	}
-	l := lang.Elem(int(b))
-	if l[3] == 0 {
-		return l[:3]
-	}
-	return l[:2]
-}
-
-// ISO3 returns the ISO 639-3 language code.
-func (b Language) ISO3() string {
-	if b == 0 || b >= langNoIndexOffset {
-		return b.String()
-	}
-	l := lang.Elem(int(b))
-	if l[3] == 0 {
-		return l[:3]
-	} else if l[2] == 0 {
-		return altLangISO3.Elem(int(l[3]))[:3]
-	}
-	// This allocation will only happen for 3-letter ISO codes
-	// that are non-canonical BCP 47 language identifiers.
-	return l[0:1] + l[2:4]
-}
-
-// IsPrivateUse reports whether this language code is reserved for private use.
-func (b Language) IsPrivateUse() bool {
-	return langPrivateStart <= b && b <= langPrivateEnd
-}
-
-// SuppressScript returns the script marked as SuppressScript in the IANA
-// language tag repository, or 0 if there is no such script.
-func (b Language) SuppressScript() Script {
-	if b < langNoIndexOffset {
-		return Script(suppressScript[b])
-	}
-	return 0
-}
-
-type Region uint16
-
-// getRegionID returns the region id for s if s is a valid 2-letter region code
-// or unknownRegion.
-func getRegionID(s []byte) (Region, error) {
-	if len(s) == 3 {
-		if isAlpha(s[0]) {
-			return getRegionISO3(s)
-		}
-		if i, err := strconv.ParseUint(string(s), 10, 10); err == nil {
-			return getRegionM49(int(i))
-		}
-	}
-	return getRegionISO2(s)
-}
-
-// getRegionISO2 returns the regionID for the given 2-letter ISO country code
-// or unknownRegion if this does not exist.
-func getRegionISO2(s []byte) (Region, error) {
-	i, err := findIndex(regionISO, s, "ZZ")
-	if err != nil {
-		return 0, err
-	}
-	return Region(i) + isoRegionOffset, nil
-}
-
-// getRegionISO3 returns the regionID for the given 3-letter ISO country code
-// or unknownRegion if this does not exist.
-func getRegionISO3(s []byte) (Region, error) {
-	if tag.FixCase("ZZZ", s) {
-		for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) {
-			if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] {
-				return Region(i) + isoRegionOffset, nil
-			}
-		}
-		for i := 0; i < len(altRegionISO3); i += 3 {
-			if tag.Compare(altRegionISO3[i:i+3], s) == 0 {
-				return Region(altRegionIDs[i/3]), nil
-			}
-		}
-		return 0, NewValueError(s)
-	}
-	return 0, ErrSyntax
-}
-
-func getRegionM49(n int) (Region, error) {
-	if 0 < n && n <= 999 {
-		const (
-			searchBits = 7
-			regionBits = 9
-			regionMask = 1<<regionBits - 1
-		)
-		idx := n >> searchBits
-		buf := fromM49[m49Index[idx]:m49Index[idx+1]]
-		val := uint16(n) << regionBits // we rely on bits shifting out
-		i := sort.Search(len(buf), func(i int) bool {
-			return buf[i] >= val
-		})
-		if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val {
-			return Region(r & regionMask), nil
-		}
-	}
-	var e ValueError
-	fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n)
-	return 0, e
-}
-
-// normRegion returns a region if r is deprecated or 0 otherwise.
-// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ).
-// TODO: consider mapping split up regions to new most populous one (like CLDR).
-func normRegion(r Region) Region {
-	m := regionOldMap
-	k := sort.Search(len(m), func(i int) bool {
-		return m[i].From >= uint16(r)
-	})
-	if k < len(m) && m[k].From == uint16(r) {
-		return Region(m[k].To)
-	}
-	return 0
-}
-
-const (
-	iso3166UserAssigned = 1 << iota
-	ccTLD
-	bcp47Region
-)
-
-func (r Region) typ() byte {
-	return regionTypes[r]
-}
-
-// String returns the BCP 47 representation for the region.
-// It returns "ZZ" for an unspecified region.
-func (r Region) String() string {
-	if r < isoRegionOffset {
-		if r == 0 {
-			return "ZZ"
-		}
-		return fmt.Sprintf("%03d", r.M49())
-	}
-	r -= isoRegionOffset
-	return regionISO.Elem(int(r))[:2]
-}
-
-// ISO3 returns the 3-letter ISO code of r.
-// Note that not all regions have a 3-letter ISO code.
-// In such cases this method returns "ZZZ".
-func (r Region) ISO3() string {
-	if r < isoRegionOffset {
-		return "ZZZ"
-	}
-	r -= isoRegionOffset
-	reg := regionISO.Elem(int(r))
-	switch reg[2] {
-	case 0:
-		return altRegionISO3[reg[3]:][:3]
-	case ' ':
-		return "ZZZ"
-	}
-	return reg[0:1] + reg[2:4]
-}
-
-// M49 returns the UN M.49 encoding of r, or 0 if this encoding
-// is not defined for r.
-func (r Region) M49() int {
-	return int(m49[r])
-}
-
-// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
-// may include private-use tags that are assigned by CLDR and used in this
-// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
-func (r Region) IsPrivateUse() bool {
-	return r.typ()&iso3166UserAssigned != 0
-}
-
-type Script uint8
-
-// getScriptID returns the script id for string s. It assumes that s
-// is of the format [A-Z][a-z]{3}.
-func getScriptID(idx tag.Index, s []byte) (Script, error) {
-	i, err := findIndex(idx, s, "Zzzz")
-	return Script(i), err
-}
-
-// String returns the script code in title case.
-// It returns "Zzzz" for an unspecified script.
-func (s Script) String() string {
-	if s == 0 {
-		return "Zzzz"
-	}
-	return script.Elem(int(s))
-}
-
-// IsPrivateUse reports whether this script code is reserved for private use.
-func (s Script) IsPrivateUse() bool {
-	return _Qaaa <= s && s <= _Qabx
-}
-
-const (
-	maxAltTaglen = len("en-US-POSIX")
-	maxLen       = maxAltTaglen
-)
-
-var (
-	// grandfatheredMap holds a mapping from legacy and grandfathered tags to
-	// their base language or index to more elaborate tag.
-	grandfatheredMap = map[[maxLen]byte]int16{
-		[maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban
-		[maxLen]byte{'i', '-', 'a', 'm', 'i'}:                          _ami, // i-ami
-		[maxLen]byte{'i', '-', 'b', 'n', 'n'}:                          _bnn, // i-bnn
-		[maxLen]byte{'i', '-', 'h', 'a', 'k'}:                          _hak, // i-hak
-		[maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}:      _tlh, // i-klingon
-		[maxLen]byte{'i', '-', 'l', 'u', 'x'}:                          _lb,  // i-lux
-		[maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}:           _nv,  // i-navajo
-		[maxLen]byte{'i', '-', 'p', 'w', 'n'}:                          _pwn, // i-pwn
-		[maxLen]byte{'i', '-', 't', 'a', 'o'}:                          _tao, // i-tao
-		[maxLen]byte{'i', '-', 't', 'a', 'y'}:                          _tay, // i-tay
-		[maxLen]byte{'i', '-', 't', 's', 'u'}:                          _tsu, // i-tsu
-		[maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}:                     _nb,  // no-bok
-		[maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}:                     _nn,  // no-nyn
-		[maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}:      _sfb, // sgn-BE-FR
-		[maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}:      _vgt, // sgn-BE-NL
-		[maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}:      _sgg, // sgn-CH-DE
-		[maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}:           _cmn, // zh-guoyu
-		[maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}:           _hak, // zh-hakka
-		[maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan
-		[maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}:           _hsn, // zh-xiang
-
-		// Grandfathered tags with no modern replacement will be converted as
-		// follows:
-		[maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish
-		[maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}:           -2, // en-GB-oed
-		[maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}:           -3, // i-default
-		[maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}:      -4, // i-enochian
-		[maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}:                     -5, // i-mingo
-		[maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}:                          -6, // zh-min
-
-		// CLDR-specific tag.
-		[maxLen]byte{'r', 'o', 'o', 't'}:                                    0,  // root
-		[maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX"
-	}
-
-	altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102}
-
-	altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix"
-)
-
-func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) {
-	if v, ok := grandfatheredMap[s]; ok {
-		if v < 0 {
-			return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true
-		}
-		t.LangID = Language(v)
-		return t, true
-	}
-	return t, false
-}
diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go
deleted file mode 100644
index 75a2dbca..00000000
--- a/vendor/golang.org/x/text/internal/language/match.go
+++ /dev/null
@@ -1,226 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import "errors"
-
-type scriptRegionFlags uint8
-
-const (
-	isList = 1 << iota
-	scriptInFrom
-	regionInFrom
-)
-
-func (t *Tag) setUndefinedLang(id Language) {
-	if t.LangID == 0 {
-		t.LangID = id
-	}
-}
-
-func (t *Tag) setUndefinedScript(id Script) {
-	if t.ScriptID == 0 {
-		t.ScriptID = id
-	}
-}
-
-func (t *Tag) setUndefinedRegion(id Region) {
-	if t.RegionID == 0 || t.RegionID.Contains(id) {
-		t.RegionID = id
-	}
-}
-
-// ErrMissingLikelyTagsData indicates no information was available
-// to compute likely values of missing tags.
-var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
-
-// addLikelySubtags sets subtags to their most likely value, given the locale.
-// In most cases this means setting fields for unknown values, but in some
-// cases it may alter a value.  It returns an ErrMissingLikelyTagsData error
-// if the given locale cannot be expanded.
-func (t Tag) addLikelySubtags() (Tag, error) {
-	id, err := addTags(t)
-	if err != nil {
-		return t, err
-	} else if id.equalTags(t) {
-		return t, nil
-	}
-	id.RemakeString()
-	return id, nil
-}
-
-// specializeRegion attempts to specialize a group region.
-func specializeRegion(t *Tag) bool {
-	if i := regionInclusion[t.RegionID]; i < nRegionGroups {
-		x := likelyRegionGroup[i]
-		if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID {
-			t.RegionID = Region(x.region)
-		}
-		return true
-	}
-	return false
-}
-
-// Maximize returns a new tag with missing tags filled in.
-func (t Tag) Maximize() (Tag, error) {
-	return addTags(t)
-}
-
-func addTags(t Tag) (Tag, error) {
-	// We leave private use identifiers alone.
-	if t.IsPrivateUse() {
-		return t, nil
-	}
-	if t.ScriptID != 0 && t.RegionID != 0 {
-		if t.LangID != 0 {
-			// already fully specified
-			specializeRegion(&t)
-			return t, nil
-		}
-		// Search matches for und-script-region. Note that for these cases
-		// region will never be a group so there is no need to check for this.
-		list := likelyRegion[t.RegionID : t.RegionID+1]
-		if x := list[0]; x.flags&isList != 0 {
-			list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
-		}
-		for _, x := range list {
-			// Deviating from the spec. See match_test.go for details.
-			if Script(x.script) == t.ScriptID {
-				t.setUndefinedLang(Language(x.lang))
-				return t, nil
-			}
-		}
-	}
-	if t.LangID != 0 {
-		// Search matches for lang-script and lang-region, where lang != und.
-		if t.LangID < langNoIndexOffset {
-			x := likelyLang[t.LangID]
-			if x.flags&isList != 0 {
-				list := likelyLangList[x.region : x.region+uint16(x.script)]
-				if t.ScriptID != 0 {
-					for _, x := range list {
-						if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 {
-							t.setUndefinedRegion(Region(x.region))
-							return t, nil
-						}
-					}
-				} else if t.RegionID != 0 {
-					count := 0
-					goodScript := true
-					tt := t
-					for _, x := range list {
-						// We visit all entries for which the script was not
-						// defined, including the ones where the region was not
-						// defined. This allows for proper disambiguation within
-						// regions.
-						if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) {
-							tt.RegionID = Region(x.region)
-							tt.setUndefinedScript(Script(x.script))
-							goodScript = goodScript && tt.ScriptID == Script(x.script)
-							count++
-						}
-					}
-					if count == 1 {
-						return tt, nil
-					}
-					// Even if we fail to find a unique Region, we might have
-					// an unambiguous script.
-					if goodScript {
-						t.ScriptID = tt.ScriptID
-					}
-				}
-			}
-		}
-	} else {
-		// Search matches for und-script.
-		if t.ScriptID != 0 {
-			x := likelyScript[t.ScriptID]
-			if x.region != 0 {
-				t.setUndefinedRegion(Region(x.region))
-				t.setUndefinedLang(Language(x.lang))
-				return t, nil
-			}
-		}
-		// Search matches for und-region. If und-script-region exists, it would
-		// have been found earlier.
-		if t.RegionID != 0 {
-			if i := regionInclusion[t.RegionID]; i < nRegionGroups {
-				x := likelyRegionGroup[i]
-				if x.region != 0 {
-					t.setUndefinedLang(Language(x.lang))
-					t.setUndefinedScript(Script(x.script))
-					t.RegionID = Region(x.region)
-				}
-			} else {
-				x := likelyRegion[t.RegionID]
-				if x.flags&isList != 0 {
-					x = likelyRegionList[x.lang]
-				}
-				if x.script != 0 && x.flags != scriptInFrom {
-					t.setUndefinedLang(Language(x.lang))
-					t.setUndefinedScript(Script(x.script))
-					return t, nil
-				}
-			}
-		}
-	}
-
-	// Search matches for lang.
-	if t.LangID < langNoIndexOffset {
-		x := likelyLang[t.LangID]
-		if x.flags&isList != 0 {
-			x = likelyLangList[x.region]
-		}
-		if x.region != 0 {
-			t.setUndefinedScript(Script(x.script))
-			t.setUndefinedRegion(Region(x.region))
-		}
-		specializeRegion(&t)
-		if t.LangID == 0 {
-			t.LangID = _en // default language
-		}
-		return t, nil
-	}
-	return t, ErrMissingLikelyTagsData
-}
-
-func (t *Tag) setTagsFrom(id Tag) {
-	t.LangID = id.LangID
-	t.ScriptID = id.ScriptID
-	t.RegionID = id.RegionID
-}
-
-// minimize removes the region or script subtags from t such that
-// t.addLikelySubtags() == t.minimize().addLikelySubtags().
-func (t Tag) minimize() (Tag, error) {
-	t, err := minimizeTags(t)
-	if err != nil {
-		return t, err
-	}
-	t.RemakeString()
-	return t, nil
-}
-
-// minimizeTags mimics the behavior of the ICU 51 C implementation.
-func minimizeTags(t Tag) (Tag, error) {
-	if t.equalTags(Und) {
-		return t, nil
-	}
-	max, err := addTags(t)
-	if err != nil {
-		return t, err
-	}
-	for _, id := range [...]Tag{
-		{LangID: t.LangID},
-		{LangID: t.LangID, RegionID: t.RegionID},
-		{LangID: t.LangID, ScriptID: t.ScriptID},
-	} {
-		if x, err := addTags(id); err == nil && max.equalTags(x) {
-			t.setTagsFrom(id)
-			break
-		}
-	}
-	return t, nil
-}
diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go
deleted file mode 100644
index 3c482886..00000000
--- a/vendor/golang.org/x/text/internal/language/parse.go
+++ /dev/null
@@ -1,594 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import (
-	"bytes"
-	"errors"
-	"fmt"
-	"sort"
-
-	"golang.org/x/text/internal/tag"
-)
-
-// isAlpha returns true if the byte is not a digit.
-// b must be an ASCII letter or digit.
-func isAlpha(b byte) bool {
-	return b > '9'
-}
-
-// isAlphaNum returns true if the string contains only ASCII letters or digits.
-func isAlphaNum(s []byte) bool {
-	for _, c := range s {
-		if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
-			return false
-		}
-	}
-	return true
-}
-
-// ErrSyntax is returned by any of the parsing functions when the
-// input is not well-formed, according to BCP 47.
-// TODO: return the position at which the syntax error occurred?
-var ErrSyntax = errors.New("language: tag is not well-formed")
-
-// ErrDuplicateKey is returned when a tag contains the same key twice with
-// different values in the -u section.
-var ErrDuplicateKey = errors.New("language: different values for same key in -u extension")
-
-// ValueError is returned by any of the parsing functions when the
-// input is well-formed but the respective subtag is not recognized
-// as a valid value.
-type ValueError struct {
-	v [8]byte
-}
-
-// NewValueError creates a new ValueError.
-func NewValueError(tag []byte) ValueError {
-	var e ValueError
-	copy(e.v[:], tag)
-	return e
-}
-
-func (e ValueError) tag() []byte {
-	n := bytes.IndexByte(e.v[:], 0)
-	if n == -1 {
-		n = 8
-	}
-	return e.v[:n]
-}
-
-// Error implements the error interface.
-func (e ValueError) Error() string {
-	return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
-}
-
-// Subtag returns the subtag for which the error occurred.
-func (e ValueError) Subtag() string {
-	return string(e.tag())
-}
-
-// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
-type scanner struct {
-	b     []byte
-	bytes [max99thPercentileSize]byte
-	token []byte
-	start int // start position of the current token
-	end   int // end position of the current token
-	next  int // next point for scan
-	err   error
-	done  bool
-}
-
-func makeScannerString(s string) scanner {
-	scan := scanner{}
-	if len(s) <= len(scan.bytes) {
-		scan.b = scan.bytes[:copy(scan.bytes[:], s)]
-	} else {
-		scan.b = []byte(s)
-	}
-	scan.init()
-	return scan
-}
-
-// makeScanner returns a scanner using b as the input buffer.
-// b is not copied and may be modified by the scanner routines.
-func makeScanner(b []byte) scanner {
-	scan := scanner{b: b}
-	scan.init()
-	return scan
-}
-
-func (s *scanner) init() {
-	for i, c := range s.b {
-		if c == '_' {
-			s.b[i] = '-'
-		}
-	}
-	s.scan()
-}
-
-// restToLower converts the string between start and end to lower case.
-func (s *scanner) toLower(start, end int) {
-	for i := start; i < end; i++ {
-		c := s.b[i]
-		if 'A' <= c && c <= 'Z' {
-			s.b[i] += 'a' - 'A'
-		}
-	}
-}
-
-func (s *scanner) setError(e error) {
-	if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) {
-		s.err = e
-	}
-}
-
-// resizeRange shrinks or grows the array at position oldStart such that
-// a new string of size newSize can fit between oldStart and oldEnd.
-// Sets the scan point to after the resized range.
-func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
-	s.start = oldStart
-	if end := oldStart + newSize; end != oldEnd {
-		diff := end - oldEnd
-		if end < cap(s.b) {
-			b := make([]byte, len(s.b)+diff)
-			copy(b, s.b[:oldStart])
-			copy(b[end:], s.b[oldEnd:])
-			s.b = b
-		} else {
-			s.b = append(s.b[end:], s.b[oldEnd:]...)
-		}
-		s.next = end + (s.next - s.end)
-		s.end = end
-	}
-}
-
-// replace replaces the current token with repl.
-func (s *scanner) replace(repl string) {
-	s.resizeRange(s.start, s.end, len(repl))
-	copy(s.b[s.start:], repl)
-}
-
-// gobble removes the current token from the input.
-// Caller must call scan after calling gobble.
-func (s *scanner) gobble(e error) {
-	s.setError(e)
-	if s.start == 0 {
-		s.b = s.b[:+copy(s.b, s.b[s.next:])]
-		s.end = 0
-	} else {
-		s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
-		s.end = s.start - 1
-	}
-	s.next = s.start
-}
-
-// deleteRange removes the given range from s.b before the current token.
-func (s *scanner) deleteRange(start, end int) {
-	s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
-	diff := end - start
-	s.next -= diff
-	s.start -= diff
-	s.end -= diff
-}
-
-// scan parses the next token of a BCP 47 string.  Tokens that are larger
-// than 8 characters or include non-alphanumeric characters result in an error
-// and are gobbled and removed from the output.
-// It returns the end position of the last token consumed.
-func (s *scanner) scan() (end int) {
-	end = s.end
-	s.token = nil
-	for s.start = s.next; s.next < len(s.b); {
-		i := bytes.IndexByte(s.b[s.next:], '-')
-		if i == -1 {
-			s.end = len(s.b)
-			s.next = len(s.b)
-			i = s.end - s.start
-		} else {
-			s.end = s.next + i
-			s.next = s.end + 1
-		}
-		token := s.b[s.start:s.end]
-		if i < 1 || i > 8 || !isAlphaNum(token) {
-			s.gobble(ErrSyntax)
-			continue
-		}
-		s.token = token
-		return end
-	}
-	if n := len(s.b); n > 0 && s.b[n-1] == '-' {
-		s.setError(ErrSyntax)
-		s.b = s.b[:len(s.b)-1]
-	}
-	s.done = true
-	return end
-}
-
-// acceptMinSize parses multiple tokens of the given size or greater.
-// It returns the end position of the last token consumed.
-func (s *scanner) acceptMinSize(min int) (end int) {
-	end = s.end
-	s.scan()
-	for ; len(s.token) >= min; s.scan() {
-		end = s.end
-	}
-	return end
-}
-
-// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
-// failed it returns an error and any part of the tag that could be parsed.
-// If parsing succeeded but an unknown value was found, it returns
-// ValueError. The Tag returned in this case is just stripped of the unknown
-// value. All other values are preserved. It accepts tags in the BCP 47 format
-// and extensions to this standard defined in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-func Parse(s string) (t Tag, err error) {
-	// TODO: consider supporting old-style locale key-value pairs.
-	if s == "" {
-		return Und, ErrSyntax
-	}
-	if len(s) <= maxAltTaglen {
-		b := [maxAltTaglen]byte{}
-		for i, c := range s {
-			// Generating invalid UTF-8 is okay as it won't match.
-			if 'A' <= c && c <= 'Z' {
-				c += 'a' - 'A'
-			} else if c == '_' {
-				c = '-'
-			}
-			b[i] = byte(c)
-		}
-		if t, ok := grandfathered(b); ok {
-			return t, nil
-		}
-	}
-	scan := makeScannerString(s)
-	return parse(&scan, s)
-}
-
-func parse(scan *scanner, s string) (t Tag, err error) {
-	t = Und
-	var end int
-	if n := len(scan.token); n <= 1 {
-		scan.toLower(0, len(scan.b))
-		if n == 0 || scan.token[0] != 'x' {
-			return t, ErrSyntax
-		}
-		end = parseExtensions(scan)
-	} else if n >= 4 {
-		return Und, ErrSyntax
-	} else { // the usual case
-		t, end = parseTag(scan)
-		if n := len(scan.token); n == 1 {
-			t.pExt = uint16(end)
-			end = parseExtensions(scan)
-		} else if end < len(scan.b) {
-			scan.setError(ErrSyntax)
-			scan.b = scan.b[:end]
-		}
-	}
-	if int(t.pVariant) < len(scan.b) {
-		if end < len(s) {
-			s = s[:end]
-		}
-		if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
-			t.str = s
-		} else {
-			t.str = string(scan.b)
-		}
-	} else {
-		t.pVariant, t.pExt = 0, 0
-	}
-	return t, scan.err
-}
-
-// parseTag parses language, script, region and variants.
-// It returns a Tag and the end position in the input that was parsed.
-func parseTag(scan *scanner) (t Tag, end int) {
-	var e error
-	// TODO: set an error if an unknown lang, script or region is encountered.
-	t.LangID, e = getLangID(scan.token)
-	scan.setError(e)
-	scan.replace(t.LangID.String())
-	langStart := scan.start
-	end = scan.scan()
-	for len(scan.token) == 3 && isAlpha(scan.token[0]) {
-		// From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
-		// to a tag of the form <extlang>.
-		lang, e := getLangID(scan.token)
-		if lang != 0 {
-			t.LangID = lang
-			copy(scan.b[langStart:], lang.String())
-			scan.b[langStart+3] = '-'
-			scan.start = langStart + 4
-		}
-		scan.gobble(e)
-		end = scan.scan()
-	}
-	if len(scan.token) == 4 && isAlpha(scan.token[0]) {
-		t.ScriptID, e = getScriptID(script, scan.token)
-		if t.ScriptID == 0 {
-			scan.gobble(e)
-		}
-		end = scan.scan()
-	}
-	if n := len(scan.token); n >= 2 && n <= 3 {
-		t.RegionID, e = getRegionID(scan.token)
-		if t.RegionID == 0 {
-			scan.gobble(e)
-		} else {
-			scan.replace(t.RegionID.String())
-		}
-		end = scan.scan()
-	}
-	scan.toLower(scan.start, len(scan.b))
-	t.pVariant = byte(end)
-	end = parseVariants(scan, end, t)
-	t.pExt = uint16(end)
-	return t, end
-}
-
-var separator = []byte{'-'}
-
-// parseVariants scans tokens as long as each token is a valid variant string.
-// Duplicate variants are removed.
-func parseVariants(scan *scanner, end int, t Tag) int {
-	start := scan.start
-	varIDBuf := [4]uint8{}
-	variantBuf := [4][]byte{}
-	varID := varIDBuf[:0]
-	variant := variantBuf[:0]
-	last := -1
-	needSort := false
-	for ; len(scan.token) >= 4; scan.scan() {
-		// TODO: measure the impact of needing this conversion and redesign
-		// the data structure if there is an issue.
-		v, ok := variantIndex[string(scan.token)]
-		if !ok {
-			// unknown variant
-			// TODO: allow user-defined variants?
-			scan.gobble(NewValueError(scan.token))
-			continue
-		}
-		varID = append(varID, v)
-		variant = append(variant, scan.token)
-		if !needSort {
-			if last < int(v) {
-				last = int(v)
-			} else {
-				needSort = true
-				// There is no legal combinations of more than 7 variants
-				// (and this is by no means a useful sequence).
-				const maxVariants = 8
-				if len(varID) > maxVariants {
-					break
-				}
-			}
-		}
-		end = scan.end
-	}
-	if needSort {
-		sort.Sort(variantsSort{varID, variant})
-		k, l := 0, -1
-		for i, v := range varID {
-			w := int(v)
-			if l == w {
-				// Remove duplicates.
-				continue
-			}
-			varID[k] = varID[i]
-			variant[k] = variant[i]
-			k++
-			l = w
-		}
-		if str := bytes.Join(variant[:k], separator); len(str) == 0 {
-			end = start - 1
-		} else {
-			scan.resizeRange(start, end, len(str))
-			copy(scan.b[scan.start:], str)
-			end = scan.end
-		}
-	}
-	return end
-}
-
-type variantsSort struct {
-	i []uint8
-	v [][]byte
-}
-
-func (s variantsSort) Len() int {
-	return len(s.i)
-}
-
-func (s variantsSort) Swap(i, j int) {
-	s.i[i], s.i[j] = s.i[j], s.i[i]
-	s.v[i], s.v[j] = s.v[j], s.v[i]
-}
-
-func (s variantsSort) Less(i, j int) bool {
-	return s.i[i] < s.i[j]
-}
-
-type bytesSort struct {
-	b [][]byte
-	n int // first n bytes to compare
-}
-
-func (b bytesSort) Len() int {
-	return len(b.b)
-}
-
-func (b bytesSort) Swap(i, j int) {
-	b.b[i], b.b[j] = b.b[j], b.b[i]
-}
-
-func (b bytesSort) Less(i, j int) bool {
-	for k := 0; k < b.n; k++ {
-		if b.b[i][k] == b.b[j][k] {
-			continue
-		}
-		return b.b[i][k] < b.b[j][k]
-	}
-	return false
-}
-
-// parseExtensions parses and normalizes the extensions in the buffer.
-// It returns the last position of scan.b that is part of any extension.
-// It also trims scan.b to remove excess parts accordingly.
-func parseExtensions(scan *scanner) int {
-	start := scan.start
-	exts := [][]byte{}
-	private := []byte{}
-	end := scan.end
-	for len(scan.token) == 1 {
-		extStart := scan.start
-		ext := scan.token[0]
-		end = parseExtension(scan)
-		extension := scan.b[extStart:end]
-		if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
-			scan.setError(ErrSyntax)
-			end = extStart
-			continue
-		} else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
-			scan.b = scan.b[:end]
-			return end
-		} else if ext == 'x' {
-			private = extension
-			break
-		}
-		exts = append(exts, extension)
-	}
-	sort.Sort(bytesSort{exts, 1})
-	if len(private) > 0 {
-		exts = append(exts, private)
-	}
-	scan.b = scan.b[:start]
-	if len(exts) > 0 {
-		scan.b = append(scan.b, bytes.Join(exts, separator)...)
-	} else if start > 0 {
-		// Strip trailing '-'.
-		scan.b = scan.b[:start-1]
-	}
-	return end
-}
-
-// parseExtension parses a single extension and returns the position of
-// the extension end.
-func parseExtension(scan *scanner) int {
-	start, end := scan.start, scan.end
-	switch scan.token[0] {
-	case 'u':
-		attrStart := end
-		scan.scan()
-		for last := []byte{}; len(scan.token) > 2; scan.scan() {
-			if bytes.Compare(scan.token, last) != -1 {
-				// Attributes are unsorted. Start over from scratch.
-				p := attrStart + 1
-				scan.next = p
-				attrs := [][]byte{}
-				for scan.scan(); len(scan.token) > 2; scan.scan() {
-					attrs = append(attrs, scan.token)
-					end = scan.end
-				}
-				sort.Sort(bytesSort{attrs, 3})
-				copy(scan.b[p:], bytes.Join(attrs, separator))
-				break
-			}
-			last = scan.token
-			end = scan.end
-		}
-		var last, key []byte
-		for attrEnd := end; len(scan.token) == 2; last = key {
-			key = scan.token
-			keyEnd := scan.end
-			end = scan.acceptMinSize(3)
-			// TODO: check key value validity
-			if keyEnd == end || bytes.Compare(key, last) != 1 {
-				// We have an invalid key or the keys are not sorted.
-				// Start scanning keys from scratch and reorder.
-				p := attrEnd + 1
-				scan.next = p
-				keys := [][]byte{}
-				for scan.scan(); len(scan.token) == 2; {
-					keyStart, keyEnd := scan.start, scan.end
-					end = scan.acceptMinSize(3)
-					if keyEnd != end {
-						keys = append(keys, scan.b[keyStart:end])
-					} else {
-						scan.setError(ErrSyntax)
-						end = keyStart
-					}
-				}
-				sort.Stable(bytesSort{keys, 2})
-				if n := len(keys); n > 0 {
-					k := 0
-					for i := 1; i < n; i++ {
-						if !bytes.Equal(keys[k][:2], keys[i][:2]) {
-							k++
-							keys[k] = keys[i]
-						} else if !bytes.Equal(keys[k], keys[i]) {
-							scan.setError(ErrDuplicateKey)
-						}
-					}
-					keys = keys[:k+1]
-				}
-				reordered := bytes.Join(keys, separator)
-				if e := p + len(reordered); e < end {
-					scan.deleteRange(e, end)
-					end = e
-				}
-				copy(scan.b[p:], reordered)
-				break
-			}
-		}
-	case 't':
-		scan.scan()
-		if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
-			_, end = parseTag(scan)
-			scan.toLower(start, end)
-		}
-		for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
-			end = scan.acceptMinSize(3)
-		}
-	case 'x':
-		end = scan.acceptMinSize(1)
-	default:
-		end = scan.acceptMinSize(2)
-	}
-	return end
-}
-
-// getExtension returns the name, body and end position of the extension.
-func getExtension(s string, p int) (end int, ext string) {
-	if s[p] == '-' {
-		p++
-	}
-	if s[p] == 'x' {
-		return len(s), s[p:]
-	}
-	end = nextExtension(s, p)
-	return end, s[p:end]
-}
-
-// nextExtension finds the next extension within the string, searching
-// for the -<char>- pattern from position p.
-// In the fast majority of cases, language tags will have at most
-// one extension and extensions tend to be small.
-func nextExtension(s string, p int) int {
-	for n := len(s) - 3; p < n; {
-		if s[p] == '-' {
-			if s[p+2] == '-' {
-				return p
-			}
-			p += 3
-		} else {
-			p++
-		}
-	}
-	return len(s)
-}
diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go
deleted file mode 100644
index 239e2d29..00000000
--- a/vendor/golang.org/x/text/internal/language/tables.go
+++ /dev/null
@@ -1,3431 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package language
-
-import "golang.org/x/text/internal/tag"
-
-// CLDRVersion is the CLDR version from which the tables in this package are derived.
-const CLDRVersion = "32"
-
-const NumLanguages = 8665
-
-const NumScripts = 242
-
-const NumRegions = 357
-
-type FromTo struct {
-	From uint16
-	To   uint16
-}
-
-const nonCanonicalUnd = 1201
-const (
-	_af  = 22
-	_am  = 39
-	_ar  = 58
-	_az  = 88
-	_bg  = 126
-	_bn  = 165
-	_ca  = 215
-	_cs  = 250
-	_da  = 257
-	_de  = 269
-	_el  = 310
-	_en  = 313
-	_es  = 318
-	_et  = 320
-	_fa  = 328
-	_fi  = 337
-	_fil = 339
-	_fr  = 350
-	_gu  = 420
-	_he  = 444
-	_hi  = 446
-	_hr  = 465
-	_hu  = 469
-	_hy  = 471
-	_id  = 481
-	_is  = 504
-	_it  = 505
-	_ja  = 512
-	_ka  = 528
-	_kk  = 578
-	_km  = 586
-	_kn  = 593
-	_ko  = 596
-	_ky  = 650
-	_lo  = 696
-	_lt  = 704
-	_lv  = 711
-	_mk  = 767
-	_ml  = 772
-	_mn  = 779
-	_mo  = 784
-	_mr  = 795
-	_ms  = 799
-	_mul = 806
-	_my  = 817
-	_nb  = 839
-	_ne  = 849
-	_nl  = 871
-	_no  = 879
-	_pa  = 925
-	_pl  = 947
-	_pt  = 960
-	_ro  = 988
-	_ru  = 994
-	_sh  = 1031
-	_si  = 1036
-	_sk  = 1042
-	_sl  = 1046
-	_sq  = 1073
-	_sr  = 1074
-	_sv  = 1092
-	_sw  = 1093
-	_ta  = 1104
-	_te  = 1121
-	_th  = 1131
-	_tl  = 1146
-	_tn  = 1152
-	_tr  = 1162
-	_uk  = 1198
-	_ur  = 1204
-	_uz  = 1212
-	_vi  = 1219
-	_zh  = 1321
-	_zu  = 1327
-	_jbo = 515
-	_ami = 1650
-	_bnn = 2357
-	_hak = 438
-	_tlh = 14467
-	_lb  = 661
-	_nv  = 899
-	_pwn = 12055
-	_tao = 14188
-	_tay = 14198
-	_tsu = 14662
-	_nn  = 874
-	_sfb = 13629
-	_vgt = 15701
-	_sgg = 13660
-	_cmn = 3007
-	_nan = 835
-	_hsn = 467
-)
-
-const langPrivateStart = 0x2f72
-
-const langPrivateEnd = 0x3179
-
-// lang holds an alphabetically sorted list of ISO-639 language identifiers.
-// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
-// For 2-byte language identifiers, the two successive bytes have the following meaning:
-//     - if the first letter of the 2- and 3-letter ISO codes are the same:
-//       the second and third letter of the 3-letter ISO code.
-//     - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
-// For 3-byte language identifiers the 4th byte is 0.
-const lang tag.Index = "" + // Size: 5324 bytes
-	"---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" +
-	"cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" +
-	"\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" +
-	"jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" +
-	"p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" +
-	"ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" +
-	"\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" +
-	"tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" +
-	"\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" +
-	"bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" +
-	"m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" +
-	"bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" +
-	"\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" +
-	"\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" +
-	"\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" +
-	"\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" +
-	"bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" +
-	"\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" +
-	"uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" +
-	"\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" +
-	"\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" +
-	"\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" +
-	"kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" +
-	"j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" +
-	"andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" +
-	"ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" +
-	"\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" +
-	"\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" +
-	"yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" +
-	"llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" +
-	"\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" +
-	"\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" +
-	"foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" +
-	"ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" +
-	"ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" +
-	"\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" +
-	"ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" +
-	"\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" +
-	"\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" +
-	"\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" +
-	"\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" +
-	"aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" +
-	"l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" +
-	"hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" +
-	"\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" +
-	"eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" +
-	"lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" +
-	"ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" +
-	"\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" +
-	"\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" +
-	"\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" +
-	"\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" +
-	"ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" +
-	"\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" +
-	"klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" +
-	"nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
-	"\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
-	"rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
-	"\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
-	"us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
-	"\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
-	"\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
-	"ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
-	"d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
-	"\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
-	"\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
-	"lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
-	"w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
-	"\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
-	"\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
-	"\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
-	"min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
-	"ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
-	"e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
-	"mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
-	"us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
-	"\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
-	"\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
-	"bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
-	"\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
-	"if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
-	"dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
-	"nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
-	"\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
-	"\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
-	"opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
-	"\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
-	"\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
-	"\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
-	"ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
-	"f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
-	"rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
-	"ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
-	"\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" +
-	"ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" +
-	"i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" +
-	"\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" +
-	"\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" +
-	"\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" +
-	"\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" +
-	"\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" +
-	"sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" +
-	"yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" +
-	"\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" +
-	"ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" +
-	"q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" +
-	"\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" +
-	"tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" +
-	"sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" +
-	"\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" +
-	"wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" +
-	"\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" +
-	"vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" +
-	"\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" +
-	"\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" +
-	"\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" +
-	"\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" +
-	"bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" +
-	"\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" +
-	"\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" +
-	"\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" +
-	"ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" +
-	"\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" +
-	"\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
-
-const langNoIndexOffset = 1330
-
-// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
-// in lookup tables. The language ids for these language codes are derived directly
-// from the letters and are not consecutive.
-// Size: 2197 bytes, 2197 elements
-var langNoIndex = [2197]uint8{
-	// Entry 0 - 3F
-	0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
-	0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
-	0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
-	0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
-	0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
-	0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
-	0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a,
-	0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
-	// Entry 40 - 7F
-	0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
-	0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
-	0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
-	0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
-	0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
-	0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
-	0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
-	0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
-	// Entry 80 - BF
-	0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff,
-	0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
-	0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
-	0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
-	0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
-	0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
-	0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
-	0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
-	// Entry C0 - FF
-	0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
-	0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56,
-	0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef,
-	0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
-	0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35,
-	0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00,
-	0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
-	0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
-	// Entry 100 - 13F
-	0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
-	0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
-	0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
-	0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
-	0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f,
-	0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
-	0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
-	0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
-	// Entry 140 - 17F
-	0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16,
-	0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
-	0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09,
-	0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
-	0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
-	0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
-	0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
-	0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03,
-	// Entry 180 - 1BF
-	0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
-	0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
-	0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
-	// Entry 1C0 - 1FF
-	0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
-	0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
-	0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
-	0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
-	0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf,
-	// Entry 200 - 23F
-	0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
-	0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
-	0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf,
-	0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3,
-	0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d,
-	0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
-	0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
-	0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
-	// Entry 240 - 27F
-	0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
-	0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0,
-	0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
-	0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
-	0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
-	0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
-	0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66,
-	// Entry 280 - 2BF
-	0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
-	0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
-	0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
-	0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
-	0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
-	0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
-	0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
-	0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
-	// Entry 2C0 - 2FF
-	0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
-	0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
-	0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
-	0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
-	0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
-	0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
-	0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
-	0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00,
-	// Entry 300 - 33F
-	0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
-	0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
-	0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
-	0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
-	0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
-	0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
-	0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
-	0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
-	// Entry 340 - 37F
-	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
-	0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
-	0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
-	0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
-	0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
-	0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
-	0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f,
-	0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
-	// Entry 380 - 3BF
-	0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
-	0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
-	0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
-	0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
-	0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
-	0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
-	0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
-	0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
-	// Entry 3C0 - 3FF
-	0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
-	0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
-	0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
-	0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11,
-	0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01,
-	0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10,
-	0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
-	0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
-	// Entry 400 - 43F
-	0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
-	0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
-	0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
-	0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
-	0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
-	0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
-	0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
-	0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
-	// Entry 440 - 47F
-	0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
-	0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
-	0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf,
-	0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
-	0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
-	0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd,
-	0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
-	0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4,
-	// Entry 480 - 4BF
-	0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb,
-	0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
-	0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
-	0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05,
-	0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
-	0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
-	0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
-	// Entry 4C0 - 4FF
-	0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed,
-	0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
-	0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
-	0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7,
-	0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
-	0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
-	0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
-	// Entry 500 - 53F
-	0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
-	0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
-	0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
-	0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7,
-	0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
-	0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
-	0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
-	0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
-	// Entry 540 - 57F
-	0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	// Entry 580 - 5BF
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
-	0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
-	0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
-	0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
-	0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
-	0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
-	0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
-	// Entry 5C0 - 5FF
-	0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
-	0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
-	0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
-	0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
-	0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20,
-	0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
-	0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
-	0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe,
-	// Entry 600 - 63F
-	0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
-	0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
-	0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
-	0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
-	0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f,
-	0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
-	0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18,
-	0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
-	// Entry 640 - 67F
-	0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c,
-	0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
-	0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98,
-	0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
-	0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4,
-	0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
-	0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
-	0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
-	// Entry 680 - 6BF
-	0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
-	0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda,
-	0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0,
-	0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
-	0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
-	0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
-	0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
-	0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f,
-	// Entry 6C0 - 6FF
-	0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
-	0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
-	0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41,
-	0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
-	0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
-	0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
-	// Entry 700 - 73F
-	0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
-	0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
-	0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
-	0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
-	0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
-	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 740 - 77F
-	0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
-	0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
-	0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
-	0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
-	0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55,
-	0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03,
-	0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
-	// Entry 780 - 7BF
-	0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
-	0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
-	0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
-	0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
-	0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41,
-	0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
-	0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
-	0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
-	// Entry 7C0 - 7FF
-	0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42,
-	0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56,
-	0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
-	0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
-	0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
-	0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
-	0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
-	0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
-	// Entry 800 - 83F
-	0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
-	0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
-	0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
-	0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
-	0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
-	0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
-	0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
-	0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
-	// Entry 840 - 87F
-	0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
-	0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
-	0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
-	0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1,
-	0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
-	0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
-	0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
-	// Entry 880 - 8BF
-	0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
-	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
-	0x0a, 0x00, 0x80, 0x00, 0x00,
-}
-
-// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
-// to 2-letter language codes that cannot be derived using the method described above.
-// Each 3-letter code is followed by its 1-byte langID.
-const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
-
-// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
-// Size: 12 bytes, 6 elements
-var altLangIndex = [6]uint16{
-	0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208,
-}
-
-// AliasMap maps langIDs to their suggested replacements.
-// Size: 656 bytes, 164 elements
-var AliasMap = [164]FromTo{
-	0:   {From: 0x82, To: 0x88},
-	1:   {From: 0x187, To: 0x1ae},
-	2:   {From: 0x1f3, To: 0x1e1},
-	3:   {From: 0x1fb, To: 0x1bc},
-	4:   {From: 0x208, To: 0x512},
-	5:   {From: 0x20f, To: 0x20e},
-	6:   {From: 0x310, To: 0x3dc},
-	7:   {From: 0x347, To: 0x36f},
-	8:   {From: 0x407, To: 0x432},
-	9:   {From: 0x47a, To: 0x153},
-	10:  {From: 0x490, To: 0x451},
-	11:  {From: 0x4a2, To: 0x21},
-	12:  {From: 0x53e, To: 0x544},
-	13:  {From: 0x58f, To: 0x12d},
-	14:  {From: 0x630, To: 0x1eb1},
-	15:  {From: 0x651, To: 0x431},
-	16:  {From: 0x662, To: 0x431},
-	17:  {From: 0x6ed, To: 0x3a},
-	18:  {From: 0x6f8, To: 0x1d7},
-	19:  {From: 0x73e, To: 0x21a1},
-	20:  {From: 0x7b3, To: 0x56},
-	21:  {From: 0x7b9, To: 0x299b},
-	22:  {From: 0x7c5, To: 0x58},
-	23:  {From: 0x7e6, To: 0x145},
-	24:  {From: 0x80c, To: 0x5a},
-	25:  {From: 0x815, To: 0x8d},
-	26:  {From: 0x87e, To: 0x810},
-	27:  {From: 0x8c3, To: 0xee3},
-	28:  {From: 0x9ef, To: 0x331},
-	29:  {From: 0xa36, To: 0x2c5},
-	30:  {From: 0xa3d, To: 0xbf},
-	31:  {From: 0xabe, To: 0x3322},
-	32:  {From: 0xb38, To: 0x529},
-	33:  {From: 0xb75, To: 0x265a},
-	34:  {From: 0xb7e, To: 0xbc3},
-	35:  {From: 0xb9b, To: 0x44e},
-	36:  {From: 0xbbc, To: 0x4229},
-	37:  {From: 0xbbf, To: 0x529},
-	38:  {From: 0xbfe, To: 0x2da7},
-	39:  {From: 0xc2e, To: 0x3181},
-	40:  {From: 0xcb9, To: 0xf3},
-	41:  {From: 0xd08, To: 0xfa},
-	42:  {From: 0xdc8, To: 0x11a},
-	43:  {From: 0xdd7, To: 0x32d},
-	44:  {From: 0xdf8, To: 0xdfb},
-	45:  {From: 0xdfe, To: 0x531},
-	46:  {From: 0xedf, To: 0x205a},
-	47:  {From: 0xeee, To: 0x2e9a},
-	48:  {From: 0xf39, To: 0x367},
-	49:  {From: 0x10d0, To: 0x140},
-	50:  {From: 0x1104, To: 0x2d0},
-	51:  {From: 0x11a0, To: 0x1ec},
-	52:  {From: 0x1279, To: 0x21},
-	53:  {From: 0x1424, To: 0x15e},
-	54:  {From: 0x1470, To: 0x14e},
-	55:  {From: 0x151f, To: 0xd9b},
-	56:  {From: 0x1523, To: 0x390},
-	57:  {From: 0x1532, To: 0x19f},
-	58:  {From: 0x1580, To: 0x210},
-	59:  {From: 0x1583, To: 0x10d},
-	60:  {From: 0x15a3, To: 0x3caf},
-	61:  {From: 0x166a, To: 0x19b},
-	62:  {From: 0x16c8, To: 0x136},
-	63:  {From: 0x1700, To: 0x29f8},
-	64:  {From: 0x1718, To: 0x194},
-	65:  {From: 0x1727, To: 0xf3f},
-	66:  {From: 0x177a, To: 0x178},
-	67:  {From: 0x1809, To: 0x17b6},
-	68:  {From: 0x1816, To: 0x18f3},
-	69:  {From: 0x188a, To: 0x436},
-	70:  {From: 0x1979, To: 0x1d01},
-	71:  {From: 0x1a74, To: 0x2bb0},
-	72:  {From: 0x1a8a, To: 0x1f8},
-	73:  {From: 0x1b5a, To: 0x1fa},
-	74:  {From: 0x1b86, To: 0x1515},
-	75:  {From: 0x1d64, To: 0x2c9b},
-	76:  {From: 0x2038, To: 0x37b1},
-	77:  {From: 0x203d, To: 0x20dd},
-	78:  {From: 0x205a, To: 0x30b},
-	79:  {From: 0x20e3, To: 0x274},
-	80:  {From: 0x20ee, To: 0x263},
-	81:  {From: 0x20f2, To: 0x22d},
-	82:  {From: 0x20f9, To: 0x256},
-	83:  {From: 0x210f, To: 0x21eb},
-	84:  {From: 0x2135, To: 0x27d},
-	85:  {From: 0x2160, To: 0x913},
-	86:  {From: 0x2199, To: 0x121},
-	87:  {From: 0x21ce, To: 0x1561},
-	88:  {From: 0x21e6, To: 0x504},
-	89:  {From: 0x21f4, To: 0x49f},
-	90:  {From: 0x222d, To: 0x121},
-	91:  {From: 0x2237, To: 0x121},
-	92:  {From: 0x2262, To: 0x92a},
-	93:  {From: 0x2316, To: 0x3226},
-	94:  {From: 0x2382, To: 0x3365},
-	95:  {From: 0x2472, To: 0x2c7},
-	96:  {From: 0x24e4, To: 0x2ff},
-	97:  {From: 0x24f0, To: 0x2fa},
-	98:  {From: 0x24fa, To: 0x31f},
-	99:  {From: 0x2550, To: 0xb5b},
-	100: {From: 0x25a9, To: 0xe2},
-	101: {From: 0x263e, To: 0x2d0},
-	102: {From: 0x26c9, To: 0x26b4},
-	103: {From: 0x26f9, To: 0x3c8},
-	104: {From: 0x2727, To: 0x3caf},
-	105: {From: 0x2765, To: 0x26b4},
-	106: {From: 0x2789, To: 0x4358},
-	107: {From: 0x28ef, To: 0x2837},
-	108: {From: 0x2914, To: 0x351},
-	109: {From: 0x2986, To: 0x2da7},
-	110: {From: 0x2b1a, To: 0x38d},
-	111: {From: 0x2bfc, To: 0x395},
-	112: {From: 0x2c3f, To: 0x3caf},
-	113: {From: 0x2cfc, To: 0x3be},
-	114: {From: 0x2d13, To: 0x597},
-	115: {From: 0x2d47, To: 0x148},
-	116: {From: 0x2d48, To: 0x148},
-	117: {From: 0x2dff, To: 0x2f1},
-	118: {From: 0x2e08, To: 0x19cc},
-	119: {From: 0x2e1a, To: 0x2d95},
-	120: {From: 0x2e21, To: 0x292},
-	121: {From: 0x2e54, To: 0x7d},
-	122: {From: 0x2e65, To: 0x2282},
-	123: {From: 0x2ea0, To: 0x2e9b},
-	124: {From: 0x2eef, To: 0x2ed7},
-	125: {From: 0x3193, To: 0x3c4},
-	126: {From: 0x3366, To: 0x338e},
-	127: {From: 0x342a, To: 0x3dc},
-	128: {From: 0x34ee, To: 0x18d0},
-	129: {From: 0x35c8, To: 0x2c9b},
-	130: {From: 0x35e6, To: 0x412},
-	131: {From: 0x3658, To: 0x246},
-	132: {From: 0x3676, To: 0x3f4},
-	133: {From: 0x36fd, To: 0x445},
-	134: {From: 0x37c0, To: 0x121},
-	135: {From: 0x3816, To: 0x38f2},
-	136: {From: 0x382b, To: 0x2c9b},
-	137: {From: 0x382f, To: 0xa9},
-	138: {From: 0x3832, To: 0x3228},
-	139: {From: 0x386c, To: 0x39a6},
-	140: {From: 0x3892, To: 0x3fc0},
-	141: {From: 0x38a5, To: 0x39d7},
-	142: {From: 0x38b4, To: 0x1fa4},
-	143: {From: 0x38b5, To: 0x2e9a},
-	144: {From: 0x395c, To: 0x47e},
-	145: {From: 0x3b4e, To: 0xd91},
-	146: {From: 0x3b78, To: 0x137},
-	147: {From: 0x3c99, To: 0x4bc},
-	148: {From: 0x3fbd, To: 0x100},
-	149: {From: 0x4208, To: 0xa91},
-	150: {From: 0x42be, To: 0x573},
-	151: {From: 0x42f9, To: 0x3f60},
-	152: {From: 0x4378, To: 0x25a},
-	153: {From: 0x43cb, To: 0x36cb},
-	154: {From: 0x43cd, To: 0x10f},
-	155: {From: 0x44af, To: 0x3322},
-	156: {From: 0x44e3, To: 0x512},
-	157: {From: 0x45ca, To: 0x2409},
-	158: {From: 0x45dd, To: 0x26dc},
-	159: {From: 0x4610, To: 0x48ae},
-	160: {From: 0x46ae, To: 0x46a0},
-	161: {From: 0x473e, To: 0x4745},
-	162: {From: 0x4916, To: 0x31f},
-	163: {From: 0x49a7, To: 0x523},
-}
-
-// Size: 164 bytes, 164 elements
-var AliasTypes = [164]AliasType{
-	// Entry 0 - 3F
-	1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
-	1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0,
-	2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0,
-	2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0,
-	// Entry 40 - 7F
-	1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1,
-	1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1,
-	2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1,
-	0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2,
-	// Entry 80 - BF
-	0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0,
-	1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0,
-	0, 1, 1, 1,
-}
-
-const (
-	_Latn = 87
-	_Hani = 54
-	_Hans = 56
-	_Hant = 57
-	_Qaaa = 139
-	_Qaai = 147
-	_Qabx = 188
-	_Zinh = 236
-	_Zyyy = 241
-	_Zzzz = 242
-)
-
-// script is an alphabetically sorted list of ISO 15924 codes. The index
-// of the script in the string, divided by 4, is the internal scriptID.
-const script tag.Index = "" + // Size: 976 bytes
-	"----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
-	"BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" +
-	"DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" +
-	"HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" +
-	"KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" +
-	"LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" +
-	"ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" +
-	"OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" +
-	"QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" +
-	"QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" +
-	"QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" +
-	"ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" +
-	"TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" +
-	"YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
-
-// suppressScript is an index from langID to the dominant script for that language,
-// if it exists.  If a script is given, it should be suppressed from the language tag.
-// Size: 1330 bytes, 1330 elements
-var suppressScript = [1330]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 40 - 7F
-	0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
-	// Entry 80 - BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry C0 - FF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 100 - 13F
-	0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00,
-	// Entry 140 - 17F
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 180 - 1BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00,
-	// Entry 1C0 - 1FF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00,
-	// Entry 200 - 23F
-	0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 240 - 27F
-	0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 280 - 2BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 2C0 - 2FF
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f,
-	// Entry 300 - 33F
-	0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	// Entry 340 - 37F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 380 - 3BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
-	// Entry 3C0 - 3FF
-	0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 400 - 43F
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	// Entry 440 - 47F
-	0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	// Entry 480 - 4BF
-	0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 4C0 - 4FF
-	0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 500 - 53F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00,
-}
-
-const (
-	_001 = 1
-	_419 = 31
-	_BR  = 65
-	_CA  = 73
-	_ES  = 110
-	_GB  = 123
-	_MD  = 188
-	_PT  = 238
-	_UK  = 306
-	_US  = 309
-	_ZZ  = 357
-	_XA  = 323
-	_XC  = 325
-	_XK  = 333
-)
-
-// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
-// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
-// the UN.M49 codes used for groups.)
-const isoRegionOffset = 32
-
-// regionTypes defines the status of a region for various standards.
-// Size: 358 bytes, 358 elements
-var regionTypes = [358]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 40 - 7F
-	0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04,
-	0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
-	0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 80 - BF
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry C0 - FF
-	0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	// Entry 100 - 13F
-	0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 140 - 17F
-	0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06,
-	0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
-}
-
-// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
-// Each 2-letter codes is followed by two bytes with the following meaning:
-//     - [A-Z}{2}: the first letter of the 2-letter code plus these two
-//                 letters form the 3-letter ISO code.
-//     - 0, n:     index into altRegionISO3.
-const regionISO tag.Index = "" + // Size: 1308 bytes
-	"AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
-	"AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
-	"BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
-	"CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
-	"HYDZZAEA  ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ  FIINFJJIFKLKFMSMFORO" +
-	"FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
-	"RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC  IDDNIERLILSR" +
-	"IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
-	"\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
-	"LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
-	"MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
-	"NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
-	"\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
-	"QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
-	"SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
-	"SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
-	"UVTWWNTZZAUAKRUGGAUK  UMMIUN  USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
-	"UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
-	"OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
-	"ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
-
-// altRegionISO3 holds a list of 3-letter region codes that cannot be
-// mapped to 2-letter codes using the default algorithm. This is a short list.
-const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
-
-// altRegionIDs holds a list of regionIDs the positions of which match those
-// of the 3-letter ISO codes in altRegionISO3.
-// Size: 22 bytes, 11 elements
-var altRegionIDs = [11]uint16{
-	0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105,
-	0x0121, 0x015f, 0x00dc,
-}
-
-// Size: 80 bytes, 20 elements
-var regionOldMap = [20]FromTo{
-	0:  {From: 0x44, To: 0xc4},
-	1:  {From: 0x58, To: 0xa7},
-	2:  {From: 0x5f, To: 0x60},
-	3:  {From: 0x66, To: 0x3b},
-	4:  {From: 0x79, To: 0x78},
-	5:  {From: 0x93, To: 0x37},
-	6:  {From: 0xa3, To: 0x133},
-	7:  {From: 0xc1, To: 0x133},
-	8:  {From: 0xd7, To: 0x13f},
-	9:  {From: 0xdc, To: 0x2b},
-	10: {From: 0xef, To: 0x133},
-	11: {From: 0xf2, To: 0xe2},
-	12: {From: 0xfc, To: 0x70},
-	13: {From: 0x103, To: 0x164},
-	14: {From: 0x12a, To: 0x126},
-	15: {From: 0x132, To: 0x7b},
-	16: {From: 0x13a, To: 0x13e},
-	17: {From: 0x141, To: 0x133},
-	18: {From: 0x15d, To: 0x15e},
-	19: {From: 0x163, To: 0x4b},
-}
-
-// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
-// codes indicating collections of regions.
-// Size: 716 bytes, 358 elements
-var m49 = [358]int16{
-	// Entry 0 - 3F
-	0, 1, 2, 3, 5, 9, 11, 13,
-	14, 15, 17, 18, 19, 21, 29, 30,
-	34, 35, 39, 53, 54, 57, 61, 142,
-	143, 145, 150, 151, 154, 155, 202, 419,
-	958, 0, 20, 784, 4, 28, 660, 8,
-	51, 530, 24, 10, 32, 16, 40, 36,
-	533, 248, 31, 70, 52, 50, 56, 854,
-	100, 48, 108, 204, 652, 60, 96, 68,
-	// Entry 40 - 7F
-	535, 76, 44, 64, 104, 74, 72, 112,
-	84, 124, 166, 180, 140, 178, 756, 384,
-	184, 152, 120, 156, 170, 0, 188, 891,
-	296, 192, 132, 531, 162, 196, 203, 278,
-	276, 0, 262, 208, 212, 214, 204, 12,
-	0, 218, 233, 818, 732, 232, 724, 231,
-	967, 0, 246, 242, 238, 583, 234, 0,
-	250, 249, 266, 826, 308, 268, 254, 831,
-	// Entry 80 - BF
-	288, 292, 304, 270, 324, 312, 226, 300,
-	239, 320, 316, 624, 328, 344, 334, 340,
-	191, 332, 348, 854, 0, 360, 372, 376,
-	833, 356, 86, 368, 364, 352, 380, 832,
-	388, 400, 392, 581, 404, 417, 116, 296,
-	174, 659, 408, 410, 414, 136, 398, 418,
-	422, 662, 438, 144, 430, 426, 440, 442,
-	428, 434, 504, 492, 498, 499, 663, 450,
-	// Entry C0 - FF
-	584, 581, 807, 466, 104, 496, 446, 580,
-	474, 478, 500, 470, 480, 462, 454, 484,
-	458, 508, 516, 540, 562, 574, 566, 548,
-	558, 528, 578, 524, 10, 520, 536, 570,
-	554, 512, 591, 0, 604, 258, 598, 608,
-	586, 616, 666, 612, 630, 275, 620, 581,
-	585, 600, 591, 634, 959, 960, 961, 962,
-	963, 964, 965, 966, 967, 968, 969, 970,
-	// Entry 100 - 13F
-	971, 972, 638, 716, 642, 688, 643, 646,
-	682, 90, 690, 729, 752, 702, 654, 705,
-	744, 703, 694, 674, 686, 706, 740, 728,
-	678, 810, 222, 534, 760, 748, 0, 796,
-	148, 260, 768, 764, 762, 772, 626, 795,
-	788, 776, 626, 792, 780, 798, 158, 834,
-	804, 800, 826, 581, 0, 840, 858, 860,
-	336, 670, 704, 862, 92, 850, 704, 548,
-	// Entry 140 - 17F
-	876, 581, 882, 973, 974, 975, 976, 977,
-	978, 979, 980, 981, 982, 983, 984, 985,
-	986, 987, 988, 989, 990, 991, 992, 993,
-	994, 995, 996, 997, 998, 720, 887, 175,
-	891, 710, 894, 180, 716, 999,
-}
-
-// m49Index gives indexes into fromM49 based on the three most significant bits
-// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
-//    fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
-// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
-// The region code is stored in the 9 lsb of the indexed value.
-// Size: 18 bytes, 9 elements
-var m49Index = [9]int16{
-	0, 59, 108, 143, 181, 220, 259, 291,
-	333,
-}
-
-// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
-// Size: 666 bytes, 333 elements
-var fromM49 = [333]uint16{
-	// Entry 0 - 3F
-	0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
-	0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
-	0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
-	0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
-	0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
-	0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
-	0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047,
-	0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18,
-	// Entry 40 - 7F
-	0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
-	0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d,
-	0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e,
-	0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f,
-	0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72,
-	0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a,
-	0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881,
-	0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884,
-	// Entry 80 - BF
-	0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d,
-	0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f,
-	0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac,
-	0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9,
-	0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd,
-	0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5,
-	0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd,
-	0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de,
-	// Entry C0 - FF
-	0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5,
-	0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2,
-	0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b,
-	0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c,
-	0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513,
-	0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11,
-	0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117,
-	0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e,
-	// Entry 100 - 13F
-	0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023,
-	0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2,
-	0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135,
-	0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e,
-	0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7,
-	0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff,
-	0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548,
-	0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550,
-	// Entry 140 - 17F
-	0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558,
-	0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65,
-}
-
-// Size: 1615 bytes
-var variantIndex = map[string]uint8{
-	"1606nict": 0x0,
-	"1694acad": 0x1,
-	"1901":     0x2,
-	"1959acad": 0x3,
-	"1994":     0x4d,
-	"1996":     0x4,
-	"abl1943":  0x5,
-	"akuapem":  0x6,
-	"alalc97":  0x4f,
-	"aluku":    0x7,
-	"ao1990":   0x8,
-	"arevela":  0x9,
-	"arevmda":  0xa,
-	"asante":   0xb,
-	"baku1926": 0xc,
-	"balanka":  0xd,
-	"barla":    0xe,
-	"basiceng": 0xf,
-	"bauddha":  0x10,
-	"biscayan": 0x11,
-	"biske":    0x48,
-	"bohoric":  0x12,
-	"boont":    0x13,
-	"colb1945": 0x14,
-	"cornu":    0x15,
-	"dajnko":   0x16,
-	"ekavsk":   0x17,
-	"emodeng":  0x18,
-	"fonipa":   0x50,
-	"fonnapa":  0x51,
-	"fonupa":   0x52,
-	"fonxsamp": 0x53,
-	"hepburn":  0x19,
-	"heploc":   0x4e,
-	"hognorsk": 0x1a,
-	"hsistemo": 0x1b,
-	"ijekavsk": 0x1c,
-	"itihasa":  0x1d,
-	"jauer":    0x1e,
-	"jyutping": 0x1f,
-	"kkcor":    0x20,
-	"kociewie": 0x21,
-	"kscor":    0x22,
-	"laukika":  0x23,
-	"lipaw":    0x49,
-	"luna1918": 0x24,
-	"metelko":  0x25,
-	"monoton":  0x26,
-	"ndyuka":   0x27,
-	"nedis":    0x28,
-	"newfound": 0x29,
-	"njiva":    0x4a,
-	"nulik":    0x2a,
-	"osojs":    0x4b,
-	"oxendict": 0x2b,
-	"pahawh2":  0x2c,
-	"pahawh3":  0x2d,
-	"pahawh4":  0x2e,
-	"pamaka":   0x2f,
-	"petr1708": 0x30,
-	"pinyin":   0x31,
-	"polyton":  0x32,
-	"puter":    0x33,
-	"rigik":    0x34,
-	"rozaj":    0x35,
-	"rumgr":    0x36,
-	"scotland": 0x37,
-	"scouse":   0x38,
-	"simple":   0x54,
-	"solba":    0x4c,
-	"sotav":    0x39,
-	"spanglis": 0x3a,
-	"surmiran": 0x3b,
-	"sursilv":  0x3c,
-	"sutsilv":  0x3d,
-	"tarask":   0x3e,
-	"uccor":    0x3f,
-	"ucrcor":   0x40,
-	"ulster":   0x41,
-	"unifon":   0x42,
-	"vaidika":  0x43,
-	"valencia": 0x44,
-	"vallader": 0x45,
-	"wadegile": 0x46,
-	"xsistemo": 0x47,
-}
-
-// variantNumSpecialized is the number of specialized variants in variants.
-const variantNumSpecialized = 79
-
-// nRegionGroups is the number of region groups.
-const nRegionGroups = 33
-
-type likelyLangRegion struct {
-	lang   uint16
-	region uint16
-}
-
-// likelyScript is a lookup table, indexed by scriptID, for the most likely
-// languages and regions given a script.
-// Size: 976 bytes, 244 elements
-var likelyScript = [244]likelyLangRegion{
-	1:   {lang: 0x14e, region: 0x84},
-	3:   {lang: 0x2a2, region: 0x106},
-	4:   {lang: 0x1f, region: 0x99},
-	5:   {lang: 0x3a, region: 0x6b},
-	7:   {lang: 0x3b, region: 0x9c},
-	8:   {lang: 0x1d7, region: 0x28},
-	9:   {lang: 0x13, region: 0x9c},
-	10:  {lang: 0x5b, region: 0x95},
-	11:  {lang: 0x60, region: 0x52},
-	12:  {lang: 0xb9, region: 0xb4},
-	13:  {lang: 0x63, region: 0x95},
-	14:  {lang: 0xa5, region: 0x35},
-	15:  {lang: 0x3e9, region: 0x99},
-	17:  {lang: 0x529, region: 0x12e},
-	18:  {lang: 0x3b1, region: 0x99},
-	19:  {lang: 0x15e, region: 0x78},
-	20:  {lang: 0xc2, region: 0x95},
-	21:  {lang: 0x9d, region: 0xe7},
-	22:  {lang: 0xdb, region: 0x35},
-	23:  {lang: 0xf3, region: 0x49},
-	24:  {lang: 0x4f0, region: 0x12b},
-	25:  {lang: 0xe7, region: 0x13e},
-	26:  {lang: 0xe5, region: 0x135},
-	28:  {lang: 0xf1, region: 0x6b},
-	30:  {lang: 0x1a0, region: 0x5d},
-	31:  {lang: 0x3e2, region: 0x106},
-	33:  {lang: 0x1be, region: 0x99},
-	36:  {lang: 0x15e, region: 0x78},
-	39:  {lang: 0x133, region: 0x6b},
-	40:  {lang: 0x431, region: 0x27},
-	41:  {lang: 0x27, region: 0x6f},
-	43:  {lang: 0x210, region: 0x7d},
-	44:  {lang: 0xfe, region: 0x38},
-	46:  {lang: 0x19b, region: 0x99},
-	47:  {lang: 0x19e, region: 0x130},
-	48:  {lang: 0x3e9, region: 0x99},
-	49:  {lang: 0x136, region: 0x87},
-	50:  {lang: 0x1a4, region: 0x99},
-	51:  {lang: 0x39d, region: 0x99},
-	52:  {lang: 0x529, region: 0x12e},
-	53:  {lang: 0x254, region: 0xab},
-	54:  {lang: 0x529, region: 0x53},
-	55:  {lang: 0x1cb, region: 0xe7},
-	56:  {lang: 0x529, region: 0x53},
-	57:  {lang: 0x529, region: 0x12e},
-	58:  {lang: 0x2fd, region: 0x9b},
-	59:  {lang: 0x1bc, region: 0x97},
-	60:  {lang: 0x200, region: 0xa2},
-	61:  {lang: 0x1c5, region: 0x12b},
-	62:  {lang: 0x1ca, region: 0xaf},
-	65:  {lang: 0x1d5, region: 0x92},
-	67:  {lang: 0x142, region: 0x9e},
-	68:  {lang: 0x254, region: 0xab},
-	69:  {lang: 0x20e, region: 0x95},
-	70:  {lang: 0x200, region: 0xa2},
-	72:  {lang: 0x135, region: 0xc4},
-	73:  {lang: 0x200, region: 0xa2},
-	74:  {lang: 0x3bb, region: 0xe8},
-	75:  {lang: 0x24a, region: 0xa6},
-	76:  {lang: 0x3fa, region: 0x99},
-	79:  {lang: 0x251, region: 0x99},
-	80:  {lang: 0x254, region: 0xab},
-	82:  {lang: 0x88, region: 0x99},
-	83:  {lang: 0x370, region: 0x123},
-	84:  {lang: 0x2b8, region: 0xaf},
-	89:  {lang: 0x29f, region: 0x99},
-	90:  {lang: 0x2a8, region: 0x99},
-	91:  {lang: 0x28f, region: 0x87},
-	92:  {lang: 0x1a0, region: 0x87},
-	93:  {lang: 0x2ac, region: 0x53},
-	95:  {lang: 0x4f4, region: 0x12b},
-	96:  {lang: 0x4f5, region: 0x12b},
-	97:  {lang: 0x1be, region: 0x99},
-	99:  {lang: 0x337, region: 0x9c},
-	100: {lang: 0x4f7, region: 0x53},
-	101: {lang: 0xa9, region: 0x53},
-	104: {lang: 0x2e8, region: 0x112},
-	105: {lang: 0x4f8, region: 0x10b},
-	106: {lang: 0x4f8, region: 0x10b},
-	107: {lang: 0x304, region: 0x99},
-	108: {lang: 0x31b, region: 0x99},
-	109: {lang: 0x30b, region: 0x53},
-	111: {lang: 0x31e, region: 0x35},
-	112: {lang: 0x30e, region: 0x99},
-	113: {lang: 0x414, region: 0xe8},
-	114: {lang: 0x331, region: 0xc4},
-	115: {lang: 0x4f9, region: 0x108},
-	116: {lang: 0x3b, region: 0xa1},
-	117: {lang: 0x353, region: 0xdb},
-	120: {lang: 0x2d0, region: 0x84},
-	121: {lang: 0x52a, region: 0x53},
-	122: {lang: 0x403, region: 0x96},
-	123: {lang: 0x3ee, region: 0x99},
-	124: {lang: 0x39b, region: 0xc5},
-	125: {lang: 0x395, region: 0x99},
-	126: {lang: 0x399, region: 0x135},
-	127: {lang: 0x429, region: 0x115},
-	128: {lang: 0x3b, region: 0x11c},
-	129: {lang: 0xfd, region: 0xc4},
-	130: {lang: 0x27d, region: 0x106},
-	131: {lang: 0x2c9, region: 0x53},
-	132: {lang: 0x39f, region: 0x9c},
-	133: {lang: 0x39f, region: 0x53},
-	135: {lang: 0x3ad, region: 0xb0},
-	137: {lang: 0x1c6, region: 0x53},
-	138: {lang: 0x4fd, region: 0x9c},
-	189: {lang: 0x3cb, region: 0x95},
-	191: {lang: 0x372, region: 0x10c},
-	192: {lang: 0x420, region: 0x97},
-	194: {lang: 0x4ff, region: 0x15e},
-	195: {lang: 0x3f0, region: 0x99},
-	196: {lang: 0x45, region: 0x135},
-	197: {lang: 0x139, region: 0x7b},
-	198: {lang: 0x3e9, region: 0x99},
-	200: {lang: 0x3e9, region: 0x99},
-	201: {lang: 0x3fa, region: 0x99},
-	202: {lang: 0x40c, region: 0xb3},
-	203: {lang: 0x433, region: 0x99},
-	204: {lang: 0xef, region: 0xc5},
-	205: {lang: 0x43e, region: 0x95},
-	206: {lang: 0x44d, region: 0x35},
-	207: {lang: 0x44e, region: 0x9b},
-	211: {lang: 0x45a, region: 0xe7},
-	212: {lang: 0x11a, region: 0x99},
-	213: {lang: 0x45e, region: 0x53},
-	214: {lang: 0x232, region: 0x53},
-	215: {lang: 0x450, region: 0x99},
-	216: {lang: 0x4a5, region: 0x53},
-	217: {lang: 0x9f, region: 0x13e},
-	218: {lang: 0x461, region: 0x99},
-	220: {lang: 0x528, region: 0xba},
-	221: {lang: 0x153, region: 0xe7},
-	222: {lang: 0x128, region: 0xcd},
-	223: {lang: 0x46b, region: 0x123},
-	224: {lang: 0xa9, region: 0x53},
-	225: {lang: 0x2ce, region: 0x99},
-	226: {lang: 0x4ad, region: 0x11c},
-	227: {lang: 0x4be, region: 0xb4},
-	229: {lang: 0x1ce, region: 0x99},
-	232: {lang: 0x3a9, region: 0x9c},
-	233: {lang: 0x22, region: 0x9b},
-	234: {lang: 0x1ea, region: 0x53},
-	235: {lang: 0xef, region: 0xc5},
-}
-
-type likelyScriptRegion struct {
-	region uint16
-	script uint8
-	flags  uint8
-}
-
-// likelyLang is a lookup table, indexed by langID, for the most likely
-// scripts and regions given incomplete information. If more entries exist for a
-// given language, region and script are the index and size respectively
-// of the list in likelyLangList.
-// Size: 5320 bytes, 1330 elements
-var likelyLang = [1330]likelyScriptRegion{
-	0:    {region: 0x135, script: 0x57, flags: 0x0},
-	1:    {region: 0x6f, script: 0x57, flags: 0x0},
-	2:    {region: 0x165, script: 0x57, flags: 0x0},
-	3:    {region: 0x165, script: 0x57, flags: 0x0},
-	4:    {region: 0x165, script: 0x57, flags: 0x0},
-	5:    {region: 0x7d, script: 0x1f, flags: 0x0},
-	6:    {region: 0x165, script: 0x57, flags: 0x0},
-	7:    {region: 0x165, script: 0x1f, flags: 0x0},
-	8:    {region: 0x80, script: 0x57, flags: 0x0},
-	9:    {region: 0x165, script: 0x57, flags: 0x0},
-	10:   {region: 0x165, script: 0x57, flags: 0x0},
-	11:   {region: 0x165, script: 0x57, flags: 0x0},
-	12:   {region: 0x95, script: 0x57, flags: 0x0},
-	13:   {region: 0x131, script: 0x57, flags: 0x0},
-	14:   {region: 0x80, script: 0x57, flags: 0x0},
-	15:   {region: 0x165, script: 0x57, flags: 0x0},
-	16:   {region: 0x165, script: 0x57, flags: 0x0},
-	17:   {region: 0x106, script: 0x1f, flags: 0x0},
-	18:   {region: 0x165, script: 0x57, flags: 0x0},
-	19:   {region: 0x9c, script: 0x9, flags: 0x0},
-	20:   {region: 0x128, script: 0x5, flags: 0x0},
-	21:   {region: 0x165, script: 0x57, flags: 0x0},
-	22:   {region: 0x161, script: 0x57, flags: 0x0},
-	23:   {region: 0x165, script: 0x57, flags: 0x0},
-	24:   {region: 0x165, script: 0x57, flags: 0x0},
-	25:   {region: 0x165, script: 0x57, flags: 0x0},
-	26:   {region: 0x165, script: 0x57, flags: 0x0},
-	27:   {region: 0x165, script: 0x57, flags: 0x0},
-	28:   {region: 0x52, script: 0x57, flags: 0x0},
-	29:   {region: 0x165, script: 0x57, flags: 0x0},
-	30:   {region: 0x165, script: 0x57, flags: 0x0},
-	31:   {region: 0x99, script: 0x4, flags: 0x0},
-	32:   {region: 0x165, script: 0x57, flags: 0x0},
-	33:   {region: 0x80, script: 0x57, flags: 0x0},
-	34:   {region: 0x9b, script: 0xe9, flags: 0x0},
-	35:   {region: 0x165, script: 0x57, flags: 0x0},
-	36:   {region: 0x165, script: 0x57, flags: 0x0},
-	37:   {region: 0x14d, script: 0x57, flags: 0x0},
-	38:   {region: 0x106, script: 0x1f, flags: 0x0},
-	39:   {region: 0x6f, script: 0x29, flags: 0x0},
-	40:   {region: 0x165, script: 0x57, flags: 0x0},
-	41:   {region: 0x165, script: 0x57, flags: 0x0},
-	42:   {region: 0xd6, script: 0x57, flags: 0x0},
-	43:   {region: 0x165, script: 0x57, flags: 0x0},
-	45:   {region: 0x165, script: 0x57, flags: 0x0},
-	46:   {region: 0x165, script: 0x57, flags: 0x0},
-	47:   {region: 0x165, script: 0x57, flags: 0x0},
-	48:   {region: 0x165, script: 0x57, flags: 0x0},
-	49:   {region: 0x165, script: 0x57, flags: 0x0},
-	50:   {region: 0x165, script: 0x57, flags: 0x0},
-	51:   {region: 0x95, script: 0x57, flags: 0x0},
-	52:   {region: 0x165, script: 0x5, flags: 0x0},
-	53:   {region: 0x122, script: 0x5, flags: 0x0},
-	54:   {region: 0x165, script: 0x57, flags: 0x0},
-	55:   {region: 0x165, script: 0x57, flags: 0x0},
-	56:   {region: 0x165, script: 0x57, flags: 0x0},
-	57:   {region: 0x165, script: 0x57, flags: 0x0},
-	58:   {region: 0x6b, script: 0x5, flags: 0x0},
-	59:   {region: 0x0, script: 0x3, flags: 0x1},
-	60:   {region: 0x165, script: 0x57, flags: 0x0},
-	61:   {region: 0x51, script: 0x57, flags: 0x0},
-	62:   {region: 0x3f, script: 0x57, flags: 0x0},
-	63:   {region: 0x67, script: 0x5, flags: 0x0},
-	65:   {region: 0xba, script: 0x5, flags: 0x0},
-	66:   {region: 0x6b, script: 0x5, flags: 0x0},
-	67:   {region: 0x99, script: 0xe, flags: 0x0},
-	68:   {region: 0x12f, script: 0x57, flags: 0x0},
-	69:   {region: 0x135, script: 0xc4, flags: 0x0},
-	70:   {region: 0x165, script: 0x57, flags: 0x0},
-	71:   {region: 0x165, script: 0x57, flags: 0x0},
-	72:   {region: 0x6e, script: 0x57, flags: 0x0},
-	73:   {region: 0x165, script: 0x57, flags: 0x0},
-	74:   {region: 0x165, script: 0x57, flags: 0x0},
-	75:   {region: 0x49, script: 0x57, flags: 0x0},
-	76:   {region: 0x165, script: 0x57, flags: 0x0},
-	77:   {region: 0x106, script: 0x1f, flags: 0x0},
-	78:   {region: 0x165, script: 0x5, flags: 0x0},
-	79:   {region: 0x165, script: 0x57, flags: 0x0},
-	80:   {region: 0x165, script: 0x57, flags: 0x0},
-	81:   {region: 0x165, script: 0x57, flags: 0x0},
-	82:   {region: 0x99, script: 0x21, flags: 0x0},
-	83:   {region: 0x165, script: 0x57, flags: 0x0},
-	84:   {region: 0x165, script: 0x57, flags: 0x0},
-	85:   {region: 0x165, script: 0x57, flags: 0x0},
-	86:   {region: 0x3f, script: 0x57, flags: 0x0},
-	87:   {region: 0x165, script: 0x57, flags: 0x0},
-	88:   {region: 0x3, script: 0x5, flags: 0x1},
-	89:   {region: 0x106, script: 0x1f, flags: 0x0},
-	90:   {region: 0xe8, script: 0x5, flags: 0x0},
-	91:   {region: 0x95, script: 0x57, flags: 0x0},
-	92:   {region: 0xdb, script: 0x21, flags: 0x0},
-	93:   {region: 0x2e, script: 0x57, flags: 0x0},
-	94:   {region: 0x52, script: 0x57, flags: 0x0},
-	95:   {region: 0x165, script: 0x57, flags: 0x0},
-	96:   {region: 0x52, script: 0xb, flags: 0x0},
-	97:   {region: 0x165, script: 0x57, flags: 0x0},
-	98:   {region: 0x165, script: 0x57, flags: 0x0},
-	99:   {region: 0x95, script: 0x57, flags: 0x0},
-	100:  {region: 0x165, script: 0x57, flags: 0x0},
-	101:  {region: 0x52, script: 0x57, flags: 0x0},
-	102:  {region: 0x165, script: 0x57, flags: 0x0},
-	103:  {region: 0x165, script: 0x57, flags: 0x0},
-	104:  {region: 0x165, script: 0x57, flags: 0x0},
-	105:  {region: 0x165, script: 0x57, flags: 0x0},
-	106:  {region: 0x4f, script: 0x57, flags: 0x0},
-	107:  {region: 0x165, script: 0x57, flags: 0x0},
-	108:  {region: 0x165, script: 0x57, flags: 0x0},
-	109:  {region: 0x165, script: 0x57, flags: 0x0},
-	110:  {region: 0x165, script: 0x29, flags: 0x0},
-	111:  {region: 0x165, script: 0x57, flags: 0x0},
-	112:  {region: 0x165, script: 0x57, flags: 0x0},
-	113:  {region: 0x47, script: 0x1f, flags: 0x0},
-	114:  {region: 0x165, script: 0x57, flags: 0x0},
-	115:  {region: 0x165, script: 0x57, flags: 0x0},
-	116:  {region: 0x10b, script: 0x5, flags: 0x0},
-	117:  {region: 0x162, script: 0x57, flags: 0x0},
-	118:  {region: 0x165, script: 0x57, flags: 0x0},
-	119:  {region: 0x95, script: 0x57, flags: 0x0},
-	120:  {region: 0x165, script: 0x57, flags: 0x0},
-	121:  {region: 0x12f, script: 0x57, flags: 0x0},
-	122:  {region: 0x52, script: 0x57, flags: 0x0},
-	123:  {region: 0x99, script: 0xd7, flags: 0x0},
-	124:  {region: 0xe8, script: 0x5, flags: 0x0},
-	125:  {region: 0x99, script: 0x21, flags: 0x0},
-	126:  {region: 0x38, script: 0x1f, flags: 0x0},
-	127:  {region: 0x99, script: 0x21, flags: 0x0},
-	128:  {region: 0xe8, script: 0x5, flags: 0x0},
-	129:  {region: 0x12b, script: 0x31, flags: 0x0},
-	131:  {region: 0x99, script: 0x21, flags: 0x0},
-	132:  {region: 0x165, script: 0x57, flags: 0x0},
-	133:  {region: 0x99, script: 0x21, flags: 0x0},
-	134:  {region: 0xe7, script: 0x57, flags: 0x0},
-	135:  {region: 0x165, script: 0x57, flags: 0x0},
-	136:  {region: 0x99, script: 0x21, flags: 0x0},
-	137:  {region: 0x165, script: 0x57, flags: 0x0},
-	138:  {region: 0x13f, script: 0x57, flags: 0x0},
-	139:  {region: 0x165, script: 0x57, flags: 0x0},
-	140:  {region: 0x165, script: 0x57, flags: 0x0},
-	141:  {region: 0xe7, script: 0x57, flags: 0x0},
-	142:  {region: 0x165, script: 0x57, flags: 0x0},
-	143:  {region: 0xd6, script: 0x57, flags: 0x0},
-	144:  {region: 0x165, script: 0x57, flags: 0x0},
-	145:  {region: 0x165, script: 0x57, flags: 0x0},
-	146:  {region: 0x165, script: 0x57, flags: 0x0},
-	147:  {region: 0x165, script: 0x29, flags: 0x0},
-	148:  {region: 0x99, script: 0x21, flags: 0x0},
-	149:  {region: 0x95, script: 0x57, flags: 0x0},
-	150:  {region: 0x165, script: 0x57, flags: 0x0},
-	151:  {region: 0x165, script: 0x57, flags: 0x0},
-	152:  {region: 0x114, script: 0x57, flags: 0x0},
-	153:  {region: 0x165, script: 0x57, flags: 0x0},
-	154:  {region: 0x165, script: 0x57, flags: 0x0},
-	155:  {region: 0x52, script: 0x57, flags: 0x0},
-	156:  {region: 0x165, script: 0x57, flags: 0x0},
-	157:  {region: 0xe7, script: 0x57, flags: 0x0},
-	158:  {region: 0x165, script: 0x57, flags: 0x0},
-	159:  {region: 0x13e, script: 0xd9, flags: 0x0},
-	160:  {region: 0xc3, script: 0x57, flags: 0x0},
-	161:  {region: 0x165, script: 0x57, flags: 0x0},
-	162:  {region: 0x165, script: 0x57, flags: 0x0},
-	163:  {region: 0xc3, script: 0x57, flags: 0x0},
-	164:  {region: 0x165, script: 0x57, flags: 0x0},
-	165:  {region: 0x35, script: 0xe, flags: 0x0},
-	166:  {region: 0x165, script: 0x57, flags: 0x0},
-	167:  {region: 0x165, script: 0x57, flags: 0x0},
-	168:  {region: 0x165, script: 0x57, flags: 0x0},
-	169:  {region: 0x53, script: 0xe0, flags: 0x0},
-	170:  {region: 0x165, script: 0x57, flags: 0x0},
-	171:  {region: 0x165, script: 0x57, flags: 0x0},
-	172:  {region: 0x165, script: 0x57, flags: 0x0},
-	173:  {region: 0x99, script: 0xe, flags: 0x0},
-	174:  {region: 0x165, script: 0x57, flags: 0x0},
-	175:  {region: 0x9c, script: 0x5, flags: 0x0},
-	176:  {region: 0x165, script: 0x57, flags: 0x0},
-	177:  {region: 0x4f, script: 0x57, flags: 0x0},
-	178:  {region: 0x78, script: 0x57, flags: 0x0},
-	179:  {region: 0x99, script: 0x21, flags: 0x0},
-	180:  {region: 0xe8, script: 0x5, flags: 0x0},
-	181:  {region: 0x99, script: 0x21, flags: 0x0},
-	182:  {region: 0x165, script: 0x57, flags: 0x0},
-	183:  {region: 0x33, script: 0x57, flags: 0x0},
-	184:  {region: 0x165, script: 0x57, flags: 0x0},
-	185:  {region: 0xb4, script: 0xc, flags: 0x0},
-	186:  {region: 0x52, script: 0x57, flags: 0x0},
-	187:  {region: 0x165, script: 0x29, flags: 0x0},
-	188:  {region: 0xe7, script: 0x57, flags: 0x0},
-	189:  {region: 0x165, script: 0x57, flags: 0x0},
-	190:  {region: 0xe8, script: 0x21, flags: 0x0},
-	191:  {region: 0x106, script: 0x1f, flags: 0x0},
-	192:  {region: 0x15f, script: 0x57, flags: 0x0},
-	193:  {region: 0x165, script: 0x57, flags: 0x0},
-	194:  {region: 0x95, script: 0x57, flags: 0x0},
-	195:  {region: 0x165, script: 0x57, flags: 0x0},
-	196:  {region: 0x52, script: 0x57, flags: 0x0},
-	197:  {region: 0x165, script: 0x57, flags: 0x0},
-	198:  {region: 0x165, script: 0x57, flags: 0x0},
-	199:  {region: 0x165, script: 0x57, flags: 0x0},
-	200:  {region: 0x86, script: 0x57, flags: 0x0},
-	201:  {region: 0x165, script: 0x57, flags: 0x0},
-	202:  {region: 0x165, script: 0x57, flags: 0x0},
-	203:  {region: 0x165, script: 0x57, flags: 0x0},
-	204:  {region: 0x165, script: 0x57, flags: 0x0},
-	205:  {region: 0x6d, script: 0x29, flags: 0x0},
-	206:  {region: 0x165, script: 0x57, flags: 0x0},
-	207:  {region: 0x165, script: 0x57, flags: 0x0},
-	208:  {region: 0x52, script: 0x57, flags: 0x0},
-	209:  {region: 0x165, script: 0x57, flags: 0x0},
-	210:  {region: 0x165, script: 0x57, flags: 0x0},
-	211:  {region: 0xc3, script: 0x57, flags: 0x0},
-	212:  {region: 0x165, script: 0x57, flags: 0x0},
-	213:  {region: 0x165, script: 0x57, flags: 0x0},
-	214:  {region: 0x165, script: 0x57, flags: 0x0},
-	215:  {region: 0x6e, script: 0x57, flags: 0x0},
-	216:  {region: 0x165, script: 0x57, flags: 0x0},
-	217:  {region: 0x165, script: 0x57, flags: 0x0},
-	218:  {region: 0xd6, script: 0x57, flags: 0x0},
-	219:  {region: 0x35, script: 0x16, flags: 0x0},
-	220:  {region: 0x106, script: 0x1f, flags: 0x0},
-	221:  {region: 0xe7, script: 0x57, flags: 0x0},
-	222:  {region: 0x165, script: 0x57, flags: 0x0},
-	223:  {region: 0x131, script: 0x57, flags: 0x0},
-	224:  {region: 0x8a, script: 0x57, flags: 0x0},
-	225:  {region: 0x75, script: 0x57, flags: 0x0},
-	226:  {region: 0x106, script: 0x1f, flags: 0x0},
-	227:  {region: 0x135, script: 0x57, flags: 0x0},
-	228:  {region: 0x49, script: 0x57, flags: 0x0},
-	229:  {region: 0x135, script: 0x1a, flags: 0x0},
-	230:  {region: 0xa6, script: 0x5, flags: 0x0},
-	231:  {region: 0x13e, script: 0x19, flags: 0x0},
-	232:  {region: 0x165, script: 0x57, flags: 0x0},
-	233:  {region: 0x9b, script: 0x5, flags: 0x0},
-	234:  {region: 0x165, script: 0x57, flags: 0x0},
-	235:  {region: 0x165, script: 0x57, flags: 0x0},
-	236:  {region: 0x165, script: 0x57, flags: 0x0},
-	237:  {region: 0x165, script: 0x57, flags: 0x0},
-	238:  {region: 0x165, script: 0x57, flags: 0x0},
-	239:  {region: 0xc5, script: 0xcc, flags: 0x0},
-	240:  {region: 0x78, script: 0x57, flags: 0x0},
-	241:  {region: 0x6b, script: 0x1c, flags: 0x0},
-	242:  {region: 0xe7, script: 0x57, flags: 0x0},
-	243:  {region: 0x49, script: 0x17, flags: 0x0},
-	244:  {region: 0x130, script: 0x1f, flags: 0x0},
-	245:  {region: 0x49, script: 0x17, flags: 0x0},
-	246:  {region: 0x49, script: 0x17, flags: 0x0},
-	247:  {region: 0x49, script: 0x17, flags: 0x0},
-	248:  {region: 0x49, script: 0x17, flags: 0x0},
-	249:  {region: 0x10a, script: 0x57, flags: 0x0},
-	250:  {region: 0x5e, script: 0x57, flags: 0x0},
-	251:  {region: 0xe9, script: 0x57, flags: 0x0},
-	252:  {region: 0x49, script: 0x17, flags: 0x0},
-	253:  {region: 0xc4, script: 0x81, flags: 0x0},
-	254:  {region: 0x8, script: 0x2, flags: 0x1},
-	255:  {region: 0x106, script: 0x1f, flags: 0x0},
-	256:  {region: 0x7b, script: 0x57, flags: 0x0},
-	257:  {region: 0x63, script: 0x57, flags: 0x0},
-	258:  {region: 0x165, script: 0x57, flags: 0x0},
-	259:  {region: 0x165, script: 0x57, flags: 0x0},
-	260:  {region: 0x165, script: 0x57, flags: 0x0},
-	261:  {region: 0x165, script: 0x57, flags: 0x0},
-	262:  {region: 0x135, script: 0x57, flags: 0x0},
-	263:  {region: 0x106, script: 0x1f, flags: 0x0},
-	264:  {region: 0xa4, script: 0x57, flags: 0x0},
-	265:  {region: 0x165, script: 0x57, flags: 0x0},
-	266:  {region: 0x165, script: 0x57, flags: 0x0},
-	267:  {region: 0x99, script: 0x5, flags: 0x0},
-	268:  {region: 0x165, script: 0x57, flags: 0x0},
-	269:  {region: 0x60, script: 0x57, flags: 0x0},
-	270:  {region: 0x165, script: 0x57, flags: 0x0},
-	271:  {region: 0x49, script: 0x57, flags: 0x0},
-	272:  {region: 0x165, script: 0x57, flags: 0x0},
-	273:  {region: 0x165, script: 0x57, flags: 0x0},
-	274:  {region: 0x165, script: 0x57, flags: 0x0},
-	275:  {region: 0x165, script: 0x5, flags: 0x0},
-	276:  {region: 0x49, script: 0x57, flags: 0x0},
-	277:  {region: 0x165, script: 0x57, flags: 0x0},
-	278:  {region: 0x165, script: 0x57, flags: 0x0},
-	279:  {region: 0xd4, script: 0x57, flags: 0x0},
-	280:  {region: 0x4f, script: 0x57, flags: 0x0},
-	281:  {region: 0x165, script: 0x57, flags: 0x0},
-	282:  {region: 0x99, script: 0x5, flags: 0x0},
-	283:  {region: 0x165, script: 0x57, flags: 0x0},
-	284:  {region: 0x165, script: 0x57, flags: 0x0},
-	285:  {region: 0x165, script: 0x57, flags: 0x0},
-	286:  {region: 0x165, script: 0x29, flags: 0x0},
-	287:  {region: 0x60, script: 0x57, flags: 0x0},
-	288:  {region: 0xc3, script: 0x57, flags: 0x0},
-	289:  {region: 0xd0, script: 0x57, flags: 0x0},
-	290:  {region: 0x165, script: 0x57, flags: 0x0},
-	291:  {region: 0xdb, script: 0x21, flags: 0x0},
-	292:  {region: 0x52, script: 0x57, flags: 0x0},
-	293:  {region: 0x165, script: 0x57, flags: 0x0},
-	294:  {region: 0x165, script: 0x57, flags: 0x0},
-	295:  {region: 0x165, script: 0x57, flags: 0x0},
-	296:  {region: 0xcd, script: 0xde, flags: 0x0},
-	297:  {region: 0x165, script: 0x57, flags: 0x0},
-	298:  {region: 0x165, script: 0x57, flags: 0x0},
-	299:  {region: 0x114, script: 0x57, flags: 0x0},
-	300:  {region: 0x37, script: 0x57, flags: 0x0},
-	301:  {region: 0x43, script: 0xe0, flags: 0x0},
-	302:  {region: 0x165, script: 0x57, flags: 0x0},
-	303:  {region: 0xa4, script: 0x57, flags: 0x0},
-	304:  {region: 0x80, script: 0x57, flags: 0x0},
-	305:  {region: 0xd6, script: 0x57, flags: 0x0},
-	306:  {region: 0x9e, script: 0x57, flags: 0x0},
-	307:  {region: 0x6b, script: 0x27, flags: 0x0},
-	308:  {region: 0x165, script: 0x57, flags: 0x0},
-	309:  {region: 0xc4, script: 0x48, flags: 0x0},
-	310:  {region: 0x87, script: 0x31, flags: 0x0},
-	311:  {region: 0x165, script: 0x57, flags: 0x0},
-	312:  {region: 0x165, script: 0x57, flags: 0x0},
-	313:  {region: 0xa, script: 0x2, flags: 0x1},
-	314:  {region: 0x165, script: 0x57, flags: 0x0},
-	315:  {region: 0x165, script: 0x57, flags: 0x0},
-	316:  {region: 0x1, script: 0x57, flags: 0x0},
-	317:  {region: 0x165, script: 0x57, flags: 0x0},
-	318:  {region: 0x6e, script: 0x57, flags: 0x0},
-	319:  {region: 0x135, script: 0x57, flags: 0x0},
-	320:  {region: 0x6a, script: 0x57, flags: 0x0},
-	321:  {region: 0x165, script: 0x57, flags: 0x0},
-	322:  {region: 0x9e, script: 0x43, flags: 0x0},
-	323:  {region: 0x165, script: 0x57, flags: 0x0},
-	324:  {region: 0x165, script: 0x57, flags: 0x0},
-	325:  {region: 0x6e, script: 0x57, flags: 0x0},
-	326:  {region: 0x52, script: 0x57, flags: 0x0},
-	327:  {region: 0x6e, script: 0x57, flags: 0x0},
-	328:  {region: 0x9c, script: 0x5, flags: 0x0},
-	329:  {region: 0x165, script: 0x57, flags: 0x0},
-	330:  {region: 0x165, script: 0x57, flags: 0x0},
-	331:  {region: 0x165, script: 0x57, flags: 0x0},
-	332:  {region: 0x165, script: 0x57, flags: 0x0},
-	333:  {region: 0x86, script: 0x57, flags: 0x0},
-	334:  {region: 0xc, script: 0x2, flags: 0x1},
-	335:  {region: 0x165, script: 0x57, flags: 0x0},
-	336:  {region: 0xc3, script: 0x57, flags: 0x0},
-	337:  {region: 0x72, script: 0x57, flags: 0x0},
-	338:  {region: 0x10b, script: 0x5, flags: 0x0},
-	339:  {region: 0xe7, script: 0x57, flags: 0x0},
-	340:  {region: 0x10c, script: 0x57, flags: 0x0},
-	341:  {region: 0x73, script: 0x57, flags: 0x0},
-	342:  {region: 0x165, script: 0x57, flags: 0x0},
-	343:  {region: 0x165, script: 0x57, flags: 0x0},
-	344:  {region: 0x76, script: 0x57, flags: 0x0},
-	345:  {region: 0x165, script: 0x57, flags: 0x0},
-	346:  {region: 0x3b, script: 0x57, flags: 0x0},
-	347:  {region: 0x165, script: 0x57, flags: 0x0},
-	348:  {region: 0x165, script: 0x57, flags: 0x0},
-	349:  {region: 0x165, script: 0x57, flags: 0x0},
-	350:  {region: 0x78, script: 0x57, flags: 0x0},
-	351:  {region: 0x135, script: 0x57, flags: 0x0},
-	352:  {region: 0x78, script: 0x57, flags: 0x0},
-	353:  {region: 0x60, script: 0x57, flags: 0x0},
-	354:  {region: 0x60, script: 0x57, flags: 0x0},
-	355:  {region: 0x52, script: 0x5, flags: 0x0},
-	356:  {region: 0x140, script: 0x57, flags: 0x0},
-	357:  {region: 0x165, script: 0x57, flags: 0x0},
-	358:  {region: 0x84, script: 0x57, flags: 0x0},
-	359:  {region: 0x165, script: 0x57, flags: 0x0},
-	360:  {region: 0xd4, script: 0x57, flags: 0x0},
-	361:  {region: 0x9e, script: 0x57, flags: 0x0},
-	362:  {region: 0xd6, script: 0x57, flags: 0x0},
-	363:  {region: 0x165, script: 0x57, flags: 0x0},
-	364:  {region: 0x10b, script: 0x57, flags: 0x0},
-	365:  {region: 0xd9, script: 0x57, flags: 0x0},
-	366:  {region: 0x96, script: 0x57, flags: 0x0},
-	367:  {region: 0x80, script: 0x57, flags: 0x0},
-	368:  {region: 0x165, script: 0x57, flags: 0x0},
-	369:  {region: 0xbc, script: 0x57, flags: 0x0},
-	370:  {region: 0x165, script: 0x57, flags: 0x0},
-	371:  {region: 0x165, script: 0x57, flags: 0x0},
-	372:  {region: 0x165, script: 0x57, flags: 0x0},
-	373:  {region: 0x53, script: 0x38, flags: 0x0},
-	374:  {region: 0x165, script: 0x57, flags: 0x0},
-	375:  {region: 0x95, script: 0x57, flags: 0x0},
-	376:  {region: 0x165, script: 0x57, flags: 0x0},
-	377:  {region: 0x165, script: 0x57, flags: 0x0},
-	378:  {region: 0x99, script: 0x21, flags: 0x0},
-	379:  {region: 0x165, script: 0x57, flags: 0x0},
-	380:  {region: 0x9c, script: 0x5, flags: 0x0},
-	381:  {region: 0x7e, script: 0x57, flags: 0x0},
-	382:  {region: 0x7b, script: 0x57, flags: 0x0},
-	383:  {region: 0x165, script: 0x57, flags: 0x0},
-	384:  {region: 0x165, script: 0x57, flags: 0x0},
-	385:  {region: 0x165, script: 0x57, flags: 0x0},
-	386:  {region: 0x165, script: 0x57, flags: 0x0},
-	387:  {region: 0x165, script: 0x57, flags: 0x0},
-	388:  {region: 0x165, script: 0x57, flags: 0x0},
-	389:  {region: 0x6f, script: 0x29, flags: 0x0},
-	390:  {region: 0x165, script: 0x57, flags: 0x0},
-	391:  {region: 0xdb, script: 0x21, flags: 0x0},
-	392:  {region: 0x165, script: 0x57, flags: 0x0},
-	393:  {region: 0xa7, script: 0x57, flags: 0x0},
-	394:  {region: 0x165, script: 0x57, flags: 0x0},
-	395:  {region: 0xe8, script: 0x5, flags: 0x0},
-	396:  {region: 0x165, script: 0x57, flags: 0x0},
-	397:  {region: 0xe8, script: 0x5, flags: 0x0},
-	398:  {region: 0x165, script: 0x57, flags: 0x0},
-	399:  {region: 0x165, script: 0x57, flags: 0x0},
-	400:  {region: 0x6e, script: 0x57, flags: 0x0},
-	401:  {region: 0x9c, script: 0x5, flags: 0x0},
-	402:  {region: 0x165, script: 0x57, flags: 0x0},
-	403:  {region: 0x165, script: 0x29, flags: 0x0},
-	404:  {region: 0xf1, script: 0x57, flags: 0x0},
-	405:  {region: 0x165, script: 0x57, flags: 0x0},
-	406:  {region: 0x165, script: 0x57, flags: 0x0},
-	407:  {region: 0x165, script: 0x57, flags: 0x0},
-	408:  {region: 0x165, script: 0x29, flags: 0x0},
-	409:  {region: 0x165, script: 0x57, flags: 0x0},
-	410:  {region: 0x99, script: 0x21, flags: 0x0},
-	411:  {region: 0x99, script: 0xda, flags: 0x0},
-	412:  {region: 0x95, script: 0x57, flags: 0x0},
-	413:  {region: 0xd9, script: 0x57, flags: 0x0},
-	414:  {region: 0x130, script: 0x2f, flags: 0x0},
-	415:  {region: 0x165, script: 0x57, flags: 0x0},
-	416:  {region: 0xe, script: 0x2, flags: 0x1},
-	417:  {region: 0x99, script: 0xe, flags: 0x0},
-	418:  {region: 0x165, script: 0x57, flags: 0x0},
-	419:  {region: 0x4e, script: 0x57, flags: 0x0},
-	420:  {region: 0x99, script: 0x32, flags: 0x0},
-	421:  {region: 0x41, script: 0x57, flags: 0x0},
-	422:  {region: 0x54, script: 0x57, flags: 0x0},
-	423:  {region: 0x165, script: 0x57, flags: 0x0},
-	424:  {region: 0x80, script: 0x57, flags: 0x0},
-	425:  {region: 0x165, script: 0x57, flags: 0x0},
-	426:  {region: 0x165, script: 0x57, flags: 0x0},
-	427:  {region: 0xa4, script: 0x57, flags: 0x0},
-	428:  {region: 0x98, script: 0x57, flags: 0x0},
-	429:  {region: 0x165, script: 0x57, flags: 0x0},
-	430:  {region: 0xdb, script: 0x21, flags: 0x0},
-	431:  {region: 0x165, script: 0x57, flags: 0x0},
-	432:  {region: 0x165, script: 0x5, flags: 0x0},
-	433:  {region: 0x49, script: 0x57, flags: 0x0},
-	434:  {region: 0x165, script: 0x5, flags: 0x0},
-	435:  {region: 0x165, script: 0x57, flags: 0x0},
-	436:  {region: 0x10, script: 0x3, flags: 0x1},
-	437:  {region: 0x165, script: 0x57, flags: 0x0},
-	438:  {region: 0x53, script: 0x38, flags: 0x0},
-	439:  {region: 0x165, script: 0x57, flags: 0x0},
-	440:  {region: 0x135, script: 0x57, flags: 0x0},
-	441:  {region: 0x24, script: 0x5, flags: 0x0},
-	442:  {region: 0x165, script: 0x57, flags: 0x0},
-	443:  {region: 0x165, script: 0x29, flags: 0x0},
-	444:  {region: 0x97, script: 0x3b, flags: 0x0},
-	445:  {region: 0x165, script: 0x57, flags: 0x0},
-	446:  {region: 0x99, script: 0x21, flags: 0x0},
-	447:  {region: 0x165, script: 0x57, flags: 0x0},
-	448:  {region: 0x73, script: 0x57, flags: 0x0},
-	449:  {region: 0x165, script: 0x57, flags: 0x0},
-	450:  {region: 0x165, script: 0x57, flags: 0x0},
-	451:  {region: 0xe7, script: 0x57, flags: 0x0},
-	452:  {region: 0x165, script: 0x57, flags: 0x0},
-	453:  {region: 0x12b, script: 0x3d, flags: 0x0},
-	454:  {region: 0x53, script: 0x89, flags: 0x0},
-	455:  {region: 0x165, script: 0x57, flags: 0x0},
-	456:  {region: 0xe8, script: 0x5, flags: 0x0},
-	457:  {region: 0x99, script: 0x21, flags: 0x0},
-	458:  {region: 0xaf, script: 0x3e, flags: 0x0},
-	459:  {region: 0xe7, script: 0x57, flags: 0x0},
-	460:  {region: 0xe8, script: 0x5, flags: 0x0},
-	461:  {region: 0xe6, script: 0x57, flags: 0x0},
-	462:  {region: 0x99, script: 0x21, flags: 0x0},
-	463:  {region: 0x99, script: 0x21, flags: 0x0},
-	464:  {region: 0x165, script: 0x57, flags: 0x0},
-	465:  {region: 0x90, script: 0x57, flags: 0x0},
-	466:  {region: 0x60, script: 0x57, flags: 0x0},
-	467:  {region: 0x53, script: 0x38, flags: 0x0},
-	468:  {region: 0x91, script: 0x57, flags: 0x0},
-	469:  {region: 0x92, script: 0x57, flags: 0x0},
-	470:  {region: 0x165, script: 0x57, flags: 0x0},
-	471:  {region: 0x28, script: 0x8, flags: 0x0},
-	472:  {region: 0xd2, script: 0x57, flags: 0x0},
-	473:  {region: 0x78, script: 0x57, flags: 0x0},
-	474:  {region: 0x165, script: 0x57, flags: 0x0},
-	475:  {region: 0x165, script: 0x57, flags: 0x0},
-	476:  {region: 0xd0, script: 0x57, flags: 0x0},
-	477:  {region: 0xd6, script: 0x57, flags: 0x0},
-	478:  {region: 0x165, script: 0x57, flags: 0x0},
-	479:  {region: 0x165, script: 0x57, flags: 0x0},
-	480:  {region: 0x165, script: 0x57, flags: 0x0},
-	481:  {region: 0x95, script: 0x57, flags: 0x0},
-	482:  {region: 0x165, script: 0x57, flags: 0x0},
-	483:  {region: 0x165, script: 0x57, flags: 0x0},
-	484:  {region: 0x165, script: 0x57, flags: 0x0},
-	486:  {region: 0x122, script: 0x57, flags: 0x0},
-	487:  {region: 0xd6, script: 0x57, flags: 0x0},
-	488:  {region: 0x165, script: 0x57, flags: 0x0},
-	489:  {region: 0x165, script: 0x57, flags: 0x0},
-	490:  {region: 0x53, script: 0xea, flags: 0x0},
-	491:  {region: 0x165, script: 0x57, flags: 0x0},
-	492:  {region: 0x135, script: 0x57, flags: 0x0},
-	493:  {region: 0x165, script: 0x57, flags: 0x0},
-	494:  {region: 0x49, script: 0x57, flags: 0x0},
-	495:  {region: 0x165, script: 0x57, flags: 0x0},
-	496:  {region: 0x165, script: 0x57, flags: 0x0},
-	497:  {region: 0xe7, script: 0x57, flags: 0x0},
-	498:  {region: 0x165, script: 0x57, flags: 0x0},
-	499:  {region: 0x95, script: 0x57, flags: 0x0},
-	500:  {region: 0x106, script: 0x1f, flags: 0x0},
-	501:  {region: 0x1, script: 0x57, flags: 0x0},
-	502:  {region: 0x165, script: 0x57, flags: 0x0},
-	503:  {region: 0x165, script: 0x57, flags: 0x0},
-	504:  {region: 0x9d, script: 0x57, flags: 0x0},
-	505:  {region: 0x9e, script: 0x57, flags: 0x0},
-	506:  {region: 0x49, script: 0x17, flags: 0x0},
-	507:  {region: 0x97, script: 0x3b, flags: 0x0},
-	508:  {region: 0x165, script: 0x57, flags: 0x0},
-	509:  {region: 0x165, script: 0x57, flags: 0x0},
-	510:  {region: 0x106, script: 0x57, flags: 0x0},
-	511:  {region: 0x165, script: 0x57, flags: 0x0},
-	512:  {region: 0xa2, script: 0x46, flags: 0x0},
-	513:  {region: 0x165, script: 0x57, flags: 0x0},
-	514:  {region: 0xa0, script: 0x57, flags: 0x0},
-	515:  {region: 0x1, script: 0x57, flags: 0x0},
-	516:  {region: 0x165, script: 0x57, flags: 0x0},
-	517:  {region: 0x165, script: 0x57, flags: 0x0},
-	518:  {region: 0x165, script: 0x57, flags: 0x0},
-	519:  {region: 0x52, script: 0x57, flags: 0x0},
-	520:  {region: 0x130, script: 0x3b, flags: 0x0},
-	521:  {region: 0x165, script: 0x57, flags: 0x0},
-	522:  {region: 0x12f, script: 0x57, flags: 0x0},
-	523:  {region: 0xdb, script: 0x21, flags: 0x0},
-	524:  {region: 0x165, script: 0x57, flags: 0x0},
-	525:  {region: 0x63, script: 0x57, flags: 0x0},
-	526:  {region: 0x95, script: 0x57, flags: 0x0},
-	527:  {region: 0x95, script: 0x57, flags: 0x0},
-	528:  {region: 0x7d, script: 0x2b, flags: 0x0},
-	529:  {region: 0x137, script: 0x1f, flags: 0x0},
-	530:  {region: 0x67, script: 0x57, flags: 0x0},
-	531:  {region: 0xc4, script: 0x57, flags: 0x0},
-	532:  {region: 0x165, script: 0x57, flags: 0x0},
-	533:  {region: 0x165, script: 0x57, flags: 0x0},
-	534:  {region: 0xd6, script: 0x57, flags: 0x0},
-	535:  {region: 0xa4, script: 0x57, flags: 0x0},
-	536:  {region: 0xc3, script: 0x57, flags: 0x0},
-	537:  {region: 0x106, script: 0x1f, flags: 0x0},
-	538:  {region: 0x165, script: 0x57, flags: 0x0},
-	539:  {region: 0x165, script: 0x57, flags: 0x0},
-	540:  {region: 0x165, script: 0x57, flags: 0x0},
-	541:  {region: 0x165, script: 0x57, flags: 0x0},
-	542:  {region: 0xd4, script: 0x5, flags: 0x0},
-	543:  {region: 0xd6, script: 0x57, flags: 0x0},
-	544:  {region: 0x164, script: 0x57, flags: 0x0},
-	545:  {region: 0x165, script: 0x57, flags: 0x0},
-	546:  {region: 0x165, script: 0x57, flags: 0x0},
-	547:  {region: 0x12f, script: 0x57, flags: 0x0},
-	548:  {region: 0x122, script: 0x5, flags: 0x0},
-	549:  {region: 0x165, script: 0x57, flags: 0x0},
-	550:  {region: 0x123, script: 0xdf, flags: 0x0},
-	551:  {region: 0x5a, script: 0x57, flags: 0x0},
-	552:  {region: 0x52, script: 0x57, flags: 0x0},
-	553:  {region: 0x165, script: 0x57, flags: 0x0},
-	554:  {region: 0x4f, script: 0x57, flags: 0x0},
-	555:  {region: 0x99, script: 0x21, flags: 0x0},
-	556:  {region: 0x99, script: 0x21, flags: 0x0},
-	557:  {region: 0x4b, script: 0x57, flags: 0x0},
-	558:  {region: 0x95, script: 0x57, flags: 0x0},
-	559:  {region: 0x165, script: 0x57, flags: 0x0},
-	560:  {region: 0x41, script: 0x57, flags: 0x0},
-	561:  {region: 0x99, script: 0x57, flags: 0x0},
-	562:  {region: 0x53, script: 0xd6, flags: 0x0},
-	563:  {region: 0x99, script: 0x21, flags: 0x0},
-	564:  {region: 0xc3, script: 0x57, flags: 0x0},
-	565:  {region: 0x165, script: 0x57, flags: 0x0},
-	566:  {region: 0x99, script: 0x72, flags: 0x0},
-	567:  {region: 0xe8, script: 0x5, flags: 0x0},
-	568:  {region: 0x165, script: 0x57, flags: 0x0},
-	569:  {region: 0xa4, script: 0x57, flags: 0x0},
-	570:  {region: 0x165, script: 0x57, flags: 0x0},
-	571:  {region: 0x12b, script: 0x57, flags: 0x0},
-	572:  {region: 0x165, script: 0x57, flags: 0x0},
-	573:  {region: 0xd2, script: 0x57, flags: 0x0},
-	574:  {region: 0x165, script: 0x57, flags: 0x0},
-	575:  {region: 0xaf, script: 0x54, flags: 0x0},
-	576:  {region: 0x165, script: 0x57, flags: 0x0},
-	577:  {region: 0x165, script: 0x57, flags: 0x0},
-	578:  {region: 0x13, script: 0x6, flags: 0x1},
-	579:  {region: 0x165, script: 0x57, flags: 0x0},
-	580:  {region: 0x52, script: 0x57, flags: 0x0},
-	581:  {region: 0x82, script: 0x57, flags: 0x0},
-	582:  {region: 0xa4, script: 0x57, flags: 0x0},
-	583:  {region: 0x165, script: 0x57, flags: 0x0},
-	584:  {region: 0x165, script: 0x57, flags: 0x0},
-	585:  {region: 0x165, script: 0x57, flags: 0x0},
-	586:  {region: 0xa6, script: 0x4b, flags: 0x0},
-	587:  {region: 0x2a, script: 0x57, flags: 0x0},
-	588:  {region: 0x165, script: 0x57, flags: 0x0},
-	589:  {region: 0x165, script: 0x57, flags: 0x0},
-	590:  {region: 0x165, script: 0x57, flags: 0x0},
-	591:  {region: 0x165, script: 0x57, flags: 0x0},
-	592:  {region: 0x165, script: 0x57, flags: 0x0},
-	593:  {region: 0x99, script: 0x4f, flags: 0x0},
-	594:  {region: 0x8b, script: 0x57, flags: 0x0},
-	595:  {region: 0x165, script: 0x57, flags: 0x0},
-	596:  {region: 0xab, script: 0x50, flags: 0x0},
-	597:  {region: 0x106, script: 0x1f, flags: 0x0},
-	598:  {region: 0x99, script: 0x21, flags: 0x0},
-	599:  {region: 0x165, script: 0x57, flags: 0x0},
-	600:  {region: 0x75, script: 0x57, flags: 0x0},
-	601:  {region: 0x165, script: 0x57, flags: 0x0},
-	602:  {region: 0xb4, script: 0x57, flags: 0x0},
-	603:  {region: 0x165, script: 0x57, flags: 0x0},
-	604:  {region: 0x165, script: 0x57, flags: 0x0},
-	605:  {region: 0x165, script: 0x57, flags: 0x0},
-	606:  {region: 0x165, script: 0x57, flags: 0x0},
-	607:  {region: 0x165, script: 0x57, flags: 0x0},
-	608:  {region: 0x165, script: 0x57, flags: 0x0},
-	609:  {region: 0x165, script: 0x57, flags: 0x0},
-	610:  {region: 0x165, script: 0x29, flags: 0x0},
-	611:  {region: 0x165, script: 0x57, flags: 0x0},
-	612:  {region: 0x106, script: 0x1f, flags: 0x0},
-	613:  {region: 0x112, script: 0x57, flags: 0x0},
-	614:  {region: 0xe7, script: 0x57, flags: 0x0},
-	615:  {region: 0x106, script: 0x57, flags: 0x0},
-	616:  {region: 0x165, script: 0x57, flags: 0x0},
-	617:  {region: 0x99, script: 0x21, flags: 0x0},
-	618:  {region: 0x99, script: 0x5, flags: 0x0},
-	619:  {region: 0x12f, script: 0x57, flags: 0x0},
-	620:  {region: 0x165, script: 0x57, flags: 0x0},
-	621:  {region: 0x52, script: 0x57, flags: 0x0},
-	622:  {region: 0x60, script: 0x57, flags: 0x0},
-	623:  {region: 0x165, script: 0x57, flags: 0x0},
-	624:  {region: 0x165, script: 0x57, flags: 0x0},
-	625:  {region: 0x165, script: 0x29, flags: 0x0},
-	626:  {region: 0x165, script: 0x57, flags: 0x0},
-	627:  {region: 0x165, script: 0x57, flags: 0x0},
-	628:  {region: 0x19, script: 0x3, flags: 0x1},
-	629:  {region: 0x165, script: 0x57, flags: 0x0},
-	630:  {region: 0x165, script: 0x57, flags: 0x0},
-	631:  {region: 0x165, script: 0x57, flags: 0x0},
-	632:  {region: 0x165, script: 0x57, flags: 0x0},
-	633:  {region: 0x106, script: 0x1f, flags: 0x0},
-	634:  {region: 0x165, script: 0x57, flags: 0x0},
-	635:  {region: 0x165, script: 0x57, flags: 0x0},
-	636:  {region: 0x165, script: 0x57, flags: 0x0},
-	637:  {region: 0x106, script: 0x1f, flags: 0x0},
-	638:  {region: 0x165, script: 0x57, flags: 0x0},
-	639:  {region: 0x95, script: 0x57, flags: 0x0},
-	640:  {region: 0xe8, script: 0x5, flags: 0x0},
-	641:  {region: 0x7b, script: 0x57, flags: 0x0},
-	642:  {region: 0x165, script: 0x57, flags: 0x0},
-	643:  {region: 0x165, script: 0x57, flags: 0x0},
-	644:  {region: 0x165, script: 0x57, flags: 0x0},
-	645:  {region: 0x165, script: 0x29, flags: 0x0},
-	646:  {region: 0x123, script: 0xdf, flags: 0x0},
-	647:  {region: 0xe8, script: 0x5, flags: 0x0},
-	648:  {region: 0x165, script: 0x57, flags: 0x0},
-	649:  {region: 0x165, script: 0x57, flags: 0x0},
-	650:  {region: 0x1c, script: 0x5, flags: 0x1},
-	651:  {region: 0x165, script: 0x57, flags: 0x0},
-	652:  {region: 0x165, script: 0x57, flags: 0x0},
-	653:  {region: 0x165, script: 0x57, flags: 0x0},
-	654:  {region: 0x138, script: 0x57, flags: 0x0},
-	655:  {region: 0x87, script: 0x5b, flags: 0x0},
-	656:  {region: 0x97, script: 0x3b, flags: 0x0},
-	657:  {region: 0x12f, script: 0x57, flags: 0x0},
-	658:  {region: 0xe8, script: 0x5, flags: 0x0},
-	659:  {region: 0x131, script: 0x57, flags: 0x0},
-	660:  {region: 0x165, script: 0x57, flags: 0x0},
-	661:  {region: 0xb7, script: 0x57, flags: 0x0},
-	662:  {region: 0x106, script: 0x1f, flags: 0x0},
-	663:  {region: 0x165, script: 0x57, flags: 0x0},
-	664:  {region: 0x95, script: 0x57, flags: 0x0},
-	665:  {region: 0x165, script: 0x57, flags: 0x0},
-	666:  {region: 0x53, script: 0xdf, flags: 0x0},
-	667:  {region: 0x165, script: 0x57, flags: 0x0},
-	668:  {region: 0x165, script: 0x57, flags: 0x0},
-	669:  {region: 0x165, script: 0x57, flags: 0x0},
-	670:  {region: 0x165, script: 0x57, flags: 0x0},
-	671:  {region: 0x99, script: 0x59, flags: 0x0},
-	672:  {region: 0x165, script: 0x57, flags: 0x0},
-	673:  {region: 0x165, script: 0x57, flags: 0x0},
-	674:  {region: 0x106, script: 0x1f, flags: 0x0},
-	675:  {region: 0x131, script: 0x57, flags: 0x0},
-	676:  {region: 0x165, script: 0x57, flags: 0x0},
-	677:  {region: 0xd9, script: 0x57, flags: 0x0},
-	678:  {region: 0x165, script: 0x57, flags: 0x0},
-	679:  {region: 0x165, script: 0x57, flags: 0x0},
-	680:  {region: 0x21, script: 0x2, flags: 0x1},
-	681:  {region: 0x165, script: 0x57, flags: 0x0},
-	682:  {region: 0x165, script: 0x57, flags: 0x0},
-	683:  {region: 0x9e, script: 0x57, flags: 0x0},
-	684:  {region: 0x53, script: 0x5d, flags: 0x0},
-	685:  {region: 0x95, script: 0x57, flags: 0x0},
-	686:  {region: 0x9c, script: 0x5, flags: 0x0},
-	687:  {region: 0x135, script: 0x57, flags: 0x0},
-	688:  {region: 0x165, script: 0x57, flags: 0x0},
-	689:  {region: 0x165, script: 0x57, flags: 0x0},
-	690:  {region: 0x99, script: 0xda, flags: 0x0},
-	691:  {region: 0x9e, script: 0x57, flags: 0x0},
-	692:  {region: 0x165, script: 0x57, flags: 0x0},
-	693:  {region: 0x4b, script: 0x57, flags: 0x0},
-	694:  {region: 0x165, script: 0x57, flags: 0x0},
-	695:  {region: 0x165, script: 0x57, flags: 0x0},
-	696:  {region: 0xaf, script: 0x54, flags: 0x0},
-	697:  {region: 0x165, script: 0x57, flags: 0x0},
-	698:  {region: 0x165, script: 0x57, flags: 0x0},
-	699:  {region: 0x4b, script: 0x57, flags: 0x0},
-	700:  {region: 0x165, script: 0x57, flags: 0x0},
-	701:  {region: 0x165, script: 0x57, flags: 0x0},
-	702:  {region: 0x162, script: 0x57, flags: 0x0},
-	703:  {region: 0x9c, script: 0x5, flags: 0x0},
-	704:  {region: 0xb6, script: 0x57, flags: 0x0},
-	705:  {region: 0xb8, script: 0x57, flags: 0x0},
-	706:  {region: 0x4b, script: 0x57, flags: 0x0},
-	707:  {region: 0x4b, script: 0x57, flags: 0x0},
-	708:  {region: 0xa4, script: 0x57, flags: 0x0},
-	709:  {region: 0xa4, script: 0x57, flags: 0x0},
-	710:  {region: 0x9c, script: 0x5, flags: 0x0},
-	711:  {region: 0xb8, script: 0x57, flags: 0x0},
-	712:  {region: 0x123, script: 0xdf, flags: 0x0},
-	713:  {region: 0x53, script: 0x38, flags: 0x0},
-	714:  {region: 0x12b, script: 0x57, flags: 0x0},
-	715:  {region: 0x95, script: 0x57, flags: 0x0},
-	716:  {region: 0x52, script: 0x57, flags: 0x0},
-	717:  {region: 0x99, script: 0x21, flags: 0x0},
-	718:  {region: 0x99, script: 0x21, flags: 0x0},
-	719:  {region: 0x95, script: 0x57, flags: 0x0},
-	720:  {region: 0x23, script: 0x3, flags: 0x1},
-	721:  {region: 0xa4, script: 0x57, flags: 0x0},
-	722:  {region: 0x165, script: 0x57, flags: 0x0},
-	723:  {region: 0xcf, script: 0x57, flags: 0x0},
-	724:  {region: 0x165, script: 0x57, flags: 0x0},
-	725:  {region: 0x165, script: 0x57, flags: 0x0},
-	726:  {region: 0x165, script: 0x57, flags: 0x0},
-	727:  {region: 0x165, script: 0x57, flags: 0x0},
-	728:  {region: 0x165, script: 0x57, flags: 0x0},
-	729:  {region: 0x165, script: 0x57, flags: 0x0},
-	730:  {region: 0x165, script: 0x57, flags: 0x0},
-	731:  {region: 0x165, script: 0x57, flags: 0x0},
-	732:  {region: 0x165, script: 0x57, flags: 0x0},
-	733:  {region: 0x165, script: 0x57, flags: 0x0},
-	734:  {region: 0x165, script: 0x57, flags: 0x0},
-	735:  {region: 0x165, script: 0x5, flags: 0x0},
-	736:  {region: 0x106, script: 0x1f, flags: 0x0},
-	737:  {region: 0xe7, script: 0x57, flags: 0x0},
-	738:  {region: 0x165, script: 0x57, flags: 0x0},
-	739:  {region: 0x95, script: 0x57, flags: 0x0},
-	740:  {region: 0x165, script: 0x29, flags: 0x0},
-	741:  {region: 0x165, script: 0x57, flags: 0x0},
-	742:  {region: 0x165, script: 0x57, flags: 0x0},
-	743:  {region: 0x165, script: 0x57, flags: 0x0},
-	744:  {region: 0x112, script: 0x57, flags: 0x0},
-	745:  {region: 0xa4, script: 0x57, flags: 0x0},
-	746:  {region: 0x165, script: 0x57, flags: 0x0},
-	747:  {region: 0x165, script: 0x57, flags: 0x0},
-	748:  {region: 0x123, script: 0x5, flags: 0x0},
-	749:  {region: 0xcc, script: 0x57, flags: 0x0},
-	750:  {region: 0x165, script: 0x57, flags: 0x0},
-	751:  {region: 0x165, script: 0x57, flags: 0x0},
-	752:  {region: 0x165, script: 0x57, flags: 0x0},
-	753:  {region: 0xbf, script: 0x57, flags: 0x0},
-	754:  {region: 0xd1, script: 0x57, flags: 0x0},
-	755:  {region: 0x165, script: 0x57, flags: 0x0},
-	756:  {region: 0x52, script: 0x57, flags: 0x0},
-	757:  {region: 0xdb, script: 0x21, flags: 0x0},
-	758:  {region: 0x12f, script: 0x57, flags: 0x0},
-	759:  {region: 0xc0, script: 0x57, flags: 0x0},
-	760:  {region: 0x165, script: 0x57, flags: 0x0},
-	761:  {region: 0x165, script: 0x57, flags: 0x0},
-	762:  {region: 0xe0, script: 0x57, flags: 0x0},
-	763:  {region: 0x165, script: 0x57, flags: 0x0},
-	764:  {region: 0x95, script: 0x57, flags: 0x0},
-	765:  {region: 0x9b, script: 0x3a, flags: 0x0},
-	766:  {region: 0x165, script: 0x57, flags: 0x0},
-	767:  {region: 0xc2, script: 0x1f, flags: 0x0},
-	768:  {region: 0x165, script: 0x5, flags: 0x0},
-	769:  {region: 0x165, script: 0x57, flags: 0x0},
-	770:  {region: 0x165, script: 0x57, flags: 0x0},
-	771:  {region: 0x165, script: 0x57, flags: 0x0},
-	772:  {region: 0x99, script: 0x6b, flags: 0x0},
-	773:  {region: 0x165, script: 0x57, flags: 0x0},
-	774:  {region: 0x165, script: 0x57, flags: 0x0},
-	775:  {region: 0x10b, script: 0x57, flags: 0x0},
-	776:  {region: 0x165, script: 0x57, flags: 0x0},
-	777:  {region: 0x165, script: 0x57, flags: 0x0},
-	778:  {region: 0x165, script: 0x57, flags: 0x0},
-	779:  {region: 0x26, script: 0x3, flags: 0x1},
-	780:  {region: 0x165, script: 0x57, flags: 0x0},
-	781:  {region: 0x165, script: 0x57, flags: 0x0},
-	782:  {region: 0x99, script: 0xe, flags: 0x0},
-	783:  {region: 0xc4, script: 0x72, flags: 0x0},
-	785:  {region: 0x165, script: 0x57, flags: 0x0},
-	786:  {region: 0x49, script: 0x57, flags: 0x0},
-	787:  {region: 0x49, script: 0x57, flags: 0x0},
-	788:  {region: 0x37, script: 0x57, flags: 0x0},
-	789:  {region: 0x165, script: 0x57, flags: 0x0},
-	790:  {region: 0x165, script: 0x57, flags: 0x0},
-	791:  {region: 0x165, script: 0x57, flags: 0x0},
-	792:  {region: 0x165, script: 0x57, flags: 0x0},
-	793:  {region: 0x165, script: 0x57, flags: 0x0},
-	794:  {region: 0x165, script: 0x57, flags: 0x0},
-	795:  {region: 0x99, script: 0x21, flags: 0x0},
-	796:  {region: 0xdb, script: 0x21, flags: 0x0},
-	797:  {region: 0x106, script: 0x1f, flags: 0x0},
-	798:  {region: 0x35, script: 0x6f, flags: 0x0},
-	799:  {region: 0x29, script: 0x3, flags: 0x1},
-	800:  {region: 0xcb, script: 0x57, flags: 0x0},
-	801:  {region: 0x165, script: 0x57, flags: 0x0},
-	802:  {region: 0x165, script: 0x57, flags: 0x0},
-	803:  {region: 0x165, script: 0x57, flags: 0x0},
-	804:  {region: 0x99, script: 0x21, flags: 0x0},
-	805:  {region: 0x52, script: 0x57, flags: 0x0},
-	807:  {region: 0x165, script: 0x57, flags: 0x0},
-	808:  {region: 0x135, script: 0x57, flags: 0x0},
-	809:  {region: 0x165, script: 0x57, flags: 0x0},
-	810:  {region: 0x165, script: 0x57, flags: 0x0},
-	811:  {region: 0xe8, script: 0x5, flags: 0x0},
-	812:  {region: 0xc3, script: 0x57, flags: 0x0},
-	813:  {region: 0x99, script: 0x21, flags: 0x0},
-	814:  {region: 0x95, script: 0x57, flags: 0x0},
-	815:  {region: 0x164, script: 0x57, flags: 0x0},
-	816:  {region: 0x165, script: 0x57, flags: 0x0},
-	817:  {region: 0xc4, script: 0x72, flags: 0x0},
-	818:  {region: 0x165, script: 0x57, flags: 0x0},
-	819:  {region: 0x165, script: 0x29, flags: 0x0},
-	820:  {region: 0x106, script: 0x1f, flags: 0x0},
-	821:  {region: 0x165, script: 0x57, flags: 0x0},
-	822:  {region: 0x131, script: 0x57, flags: 0x0},
-	823:  {region: 0x9c, script: 0x63, flags: 0x0},
-	824:  {region: 0x165, script: 0x57, flags: 0x0},
-	825:  {region: 0x165, script: 0x57, flags: 0x0},
-	826:  {region: 0x9c, script: 0x5, flags: 0x0},
-	827:  {region: 0x165, script: 0x57, flags: 0x0},
-	828:  {region: 0x165, script: 0x57, flags: 0x0},
-	829:  {region: 0x165, script: 0x57, flags: 0x0},
-	830:  {region: 0xdd, script: 0x57, flags: 0x0},
-	831:  {region: 0x165, script: 0x57, flags: 0x0},
-	832:  {region: 0x165, script: 0x57, flags: 0x0},
-	834:  {region: 0x165, script: 0x57, flags: 0x0},
-	835:  {region: 0x53, script: 0x38, flags: 0x0},
-	836:  {region: 0x9e, script: 0x57, flags: 0x0},
-	837:  {region: 0xd2, script: 0x57, flags: 0x0},
-	838:  {region: 0x165, script: 0x57, flags: 0x0},
-	839:  {region: 0xda, script: 0x57, flags: 0x0},
-	840:  {region: 0x165, script: 0x57, flags: 0x0},
-	841:  {region: 0x165, script: 0x57, flags: 0x0},
-	842:  {region: 0x165, script: 0x57, flags: 0x0},
-	843:  {region: 0xcf, script: 0x57, flags: 0x0},
-	844:  {region: 0x165, script: 0x57, flags: 0x0},
-	845:  {region: 0x165, script: 0x57, flags: 0x0},
-	846:  {region: 0x164, script: 0x57, flags: 0x0},
-	847:  {region: 0xd1, script: 0x57, flags: 0x0},
-	848:  {region: 0x60, script: 0x57, flags: 0x0},
-	849:  {region: 0xdb, script: 0x21, flags: 0x0},
-	850:  {region: 0x165, script: 0x57, flags: 0x0},
-	851:  {region: 0xdb, script: 0x21, flags: 0x0},
-	852:  {region: 0x165, script: 0x57, flags: 0x0},
-	853:  {region: 0x165, script: 0x57, flags: 0x0},
-	854:  {region: 0xd2, script: 0x57, flags: 0x0},
-	855:  {region: 0x165, script: 0x57, flags: 0x0},
-	856:  {region: 0x165, script: 0x57, flags: 0x0},
-	857:  {region: 0xd1, script: 0x57, flags: 0x0},
-	858:  {region: 0x165, script: 0x57, flags: 0x0},
-	859:  {region: 0xcf, script: 0x57, flags: 0x0},
-	860:  {region: 0xcf, script: 0x57, flags: 0x0},
-	861:  {region: 0x165, script: 0x57, flags: 0x0},
-	862:  {region: 0x165, script: 0x57, flags: 0x0},
-	863:  {region: 0x95, script: 0x57, flags: 0x0},
-	864:  {region: 0x165, script: 0x57, flags: 0x0},
-	865:  {region: 0xdf, script: 0x57, flags: 0x0},
-	866:  {region: 0x165, script: 0x57, flags: 0x0},
-	867:  {region: 0x165, script: 0x57, flags: 0x0},
-	868:  {region: 0x99, script: 0x57, flags: 0x0},
-	869:  {region: 0x165, script: 0x57, flags: 0x0},
-	870:  {region: 0x165, script: 0x57, flags: 0x0},
-	871:  {region: 0xd9, script: 0x57, flags: 0x0},
-	872:  {region: 0x52, script: 0x57, flags: 0x0},
-	873:  {region: 0x165, script: 0x57, flags: 0x0},
-	874:  {region: 0xda, script: 0x57, flags: 0x0},
-	875:  {region: 0x165, script: 0x57, flags: 0x0},
-	876:  {region: 0x52, script: 0x57, flags: 0x0},
-	877:  {region: 0x165, script: 0x57, flags: 0x0},
-	878:  {region: 0x165, script: 0x57, flags: 0x0},
-	879:  {region: 0xda, script: 0x57, flags: 0x0},
-	880:  {region: 0x123, script: 0x53, flags: 0x0},
-	881:  {region: 0x99, script: 0x21, flags: 0x0},
-	882:  {region: 0x10c, script: 0xbf, flags: 0x0},
-	883:  {region: 0x165, script: 0x57, flags: 0x0},
-	884:  {region: 0x165, script: 0x57, flags: 0x0},
-	885:  {region: 0x84, script: 0x78, flags: 0x0},
-	886:  {region: 0x161, script: 0x57, flags: 0x0},
-	887:  {region: 0x165, script: 0x57, flags: 0x0},
-	888:  {region: 0x49, script: 0x17, flags: 0x0},
-	889:  {region: 0x165, script: 0x57, flags: 0x0},
-	890:  {region: 0x161, script: 0x57, flags: 0x0},
-	891:  {region: 0x165, script: 0x57, flags: 0x0},
-	892:  {region: 0x165, script: 0x57, flags: 0x0},
-	893:  {region: 0x165, script: 0x57, flags: 0x0},
-	894:  {region: 0x165, script: 0x57, flags: 0x0},
-	895:  {region: 0x165, script: 0x57, flags: 0x0},
-	896:  {region: 0x117, script: 0x57, flags: 0x0},
-	897:  {region: 0x165, script: 0x57, flags: 0x0},
-	898:  {region: 0x165, script: 0x57, flags: 0x0},
-	899:  {region: 0x135, script: 0x57, flags: 0x0},
-	900:  {region: 0x165, script: 0x57, flags: 0x0},
-	901:  {region: 0x53, script: 0x57, flags: 0x0},
-	902:  {region: 0x165, script: 0x57, flags: 0x0},
-	903:  {region: 0xce, script: 0x57, flags: 0x0},
-	904:  {region: 0x12f, script: 0x57, flags: 0x0},
-	905:  {region: 0x131, script: 0x57, flags: 0x0},
-	906:  {region: 0x80, script: 0x57, flags: 0x0},
-	907:  {region: 0x78, script: 0x57, flags: 0x0},
-	908:  {region: 0x165, script: 0x57, flags: 0x0},
-	910:  {region: 0x165, script: 0x57, flags: 0x0},
-	911:  {region: 0x165, script: 0x57, flags: 0x0},
-	912:  {region: 0x6f, script: 0x57, flags: 0x0},
-	913:  {region: 0x165, script: 0x57, flags: 0x0},
-	914:  {region: 0x165, script: 0x57, flags: 0x0},
-	915:  {region: 0x165, script: 0x57, flags: 0x0},
-	916:  {region: 0x165, script: 0x57, flags: 0x0},
-	917:  {region: 0x99, script: 0x7d, flags: 0x0},
-	918:  {region: 0x165, script: 0x57, flags: 0x0},
-	919:  {region: 0x165, script: 0x5, flags: 0x0},
-	920:  {region: 0x7d, script: 0x1f, flags: 0x0},
-	921:  {region: 0x135, script: 0x7e, flags: 0x0},
-	922:  {region: 0x165, script: 0x5, flags: 0x0},
-	923:  {region: 0xc5, script: 0x7c, flags: 0x0},
-	924:  {region: 0x165, script: 0x57, flags: 0x0},
-	925:  {region: 0x2c, script: 0x3, flags: 0x1},
-	926:  {region: 0xe7, script: 0x57, flags: 0x0},
-	927:  {region: 0x2f, script: 0x2, flags: 0x1},
-	928:  {region: 0xe7, script: 0x57, flags: 0x0},
-	929:  {region: 0x30, script: 0x57, flags: 0x0},
-	930:  {region: 0xf0, script: 0x57, flags: 0x0},
-	931:  {region: 0x165, script: 0x57, flags: 0x0},
-	932:  {region: 0x78, script: 0x57, flags: 0x0},
-	933:  {region: 0xd6, script: 0x57, flags: 0x0},
-	934:  {region: 0x135, script: 0x57, flags: 0x0},
-	935:  {region: 0x49, script: 0x57, flags: 0x0},
-	936:  {region: 0x165, script: 0x57, flags: 0x0},
-	937:  {region: 0x9c, script: 0xe8, flags: 0x0},
-	938:  {region: 0x165, script: 0x57, flags: 0x0},
-	939:  {region: 0x60, script: 0x57, flags: 0x0},
-	940:  {region: 0x165, script: 0x5, flags: 0x0},
-	941:  {region: 0xb0, script: 0x87, flags: 0x0},
-	943:  {region: 0x165, script: 0x57, flags: 0x0},
-	944:  {region: 0x165, script: 0x57, flags: 0x0},
-	945:  {region: 0x99, script: 0x12, flags: 0x0},
-	946:  {region: 0xa4, script: 0x57, flags: 0x0},
-	947:  {region: 0xe9, script: 0x57, flags: 0x0},
-	948:  {region: 0x165, script: 0x57, flags: 0x0},
-	949:  {region: 0x9e, script: 0x57, flags: 0x0},
-	950:  {region: 0x165, script: 0x57, flags: 0x0},
-	951:  {region: 0x165, script: 0x57, flags: 0x0},
-	952:  {region: 0x87, script: 0x31, flags: 0x0},
-	953:  {region: 0x75, script: 0x57, flags: 0x0},
-	954:  {region: 0x165, script: 0x57, flags: 0x0},
-	955:  {region: 0xe8, script: 0x4a, flags: 0x0},
-	956:  {region: 0x9c, script: 0x5, flags: 0x0},
-	957:  {region: 0x1, script: 0x57, flags: 0x0},
-	958:  {region: 0x24, script: 0x5, flags: 0x0},
-	959:  {region: 0x165, script: 0x57, flags: 0x0},
-	960:  {region: 0x41, script: 0x57, flags: 0x0},
-	961:  {region: 0x165, script: 0x57, flags: 0x0},
-	962:  {region: 0x7a, script: 0x57, flags: 0x0},
-	963:  {region: 0x165, script: 0x57, flags: 0x0},
-	964:  {region: 0xe4, script: 0x57, flags: 0x0},
-	965:  {region: 0x89, script: 0x57, flags: 0x0},
-	966:  {region: 0x69, script: 0x57, flags: 0x0},
-	967:  {region: 0x165, script: 0x57, flags: 0x0},
-	968:  {region: 0x99, script: 0x21, flags: 0x0},
-	969:  {region: 0x165, script: 0x57, flags: 0x0},
-	970:  {region: 0x102, script: 0x57, flags: 0x0},
-	971:  {region: 0x95, script: 0x57, flags: 0x0},
-	972:  {region: 0x165, script: 0x57, flags: 0x0},
-	973:  {region: 0x165, script: 0x57, flags: 0x0},
-	974:  {region: 0x9e, script: 0x57, flags: 0x0},
-	975:  {region: 0x165, script: 0x5, flags: 0x0},
-	976:  {region: 0x99, script: 0x57, flags: 0x0},
-	977:  {region: 0x31, script: 0x2, flags: 0x1},
-	978:  {region: 0xdb, script: 0x21, flags: 0x0},
-	979:  {region: 0x35, script: 0xe, flags: 0x0},
-	980:  {region: 0x4e, script: 0x57, flags: 0x0},
-	981:  {region: 0x72, script: 0x57, flags: 0x0},
-	982:  {region: 0x4e, script: 0x57, flags: 0x0},
-	983:  {region: 0x9c, script: 0x5, flags: 0x0},
-	984:  {region: 0x10c, script: 0x57, flags: 0x0},
-	985:  {region: 0x3a, script: 0x57, flags: 0x0},
-	986:  {region: 0x165, script: 0x57, flags: 0x0},
-	987:  {region: 0xd1, script: 0x57, flags: 0x0},
-	988:  {region: 0x104, script: 0x57, flags: 0x0},
-	989:  {region: 0x95, script: 0x57, flags: 0x0},
-	990:  {region: 0x12f, script: 0x57, flags: 0x0},
-	991:  {region: 0x165, script: 0x57, flags: 0x0},
-	992:  {region: 0x165, script: 0x57, flags: 0x0},
-	993:  {region: 0x73, script: 0x57, flags: 0x0},
-	994:  {region: 0x106, script: 0x1f, flags: 0x0},
-	995:  {region: 0x130, script: 0x1f, flags: 0x0},
-	996:  {region: 0x109, script: 0x57, flags: 0x0},
-	997:  {region: 0x107, script: 0x57, flags: 0x0},
-	998:  {region: 0x12f, script: 0x57, flags: 0x0},
-	999:  {region: 0x165, script: 0x57, flags: 0x0},
-	1000: {region: 0xa2, script: 0x49, flags: 0x0},
-	1001: {region: 0x99, script: 0x21, flags: 0x0},
-	1002: {region: 0x80, script: 0x57, flags: 0x0},
-	1003: {region: 0x106, script: 0x1f, flags: 0x0},
-	1004: {region: 0xa4, script: 0x57, flags: 0x0},
-	1005: {region: 0x95, script: 0x57, flags: 0x0},
-	1006: {region: 0x99, script: 0x57, flags: 0x0},
-	1007: {region: 0x114, script: 0x57, flags: 0x0},
-	1008: {region: 0x99, script: 0xc3, flags: 0x0},
-	1009: {region: 0x165, script: 0x57, flags: 0x0},
-	1010: {region: 0x165, script: 0x57, flags: 0x0},
-	1011: {region: 0x12f, script: 0x57, flags: 0x0},
-	1012: {region: 0x9e, script: 0x57, flags: 0x0},
-	1013: {region: 0x99, script: 0x21, flags: 0x0},
-	1014: {region: 0x165, script: 0x5, flags: 0x0},
-	1015: {region: 0x9e, script: 0x57, flags: 0x0},
-	1016: {region: 0x7b, script: 0x57, flags: 0x0},
-	1017: {region: 0x49, script: 0x57, flags: 0x0},
-	1018: {region: 0x33, script: 0x4, flags: 0x1},
-	1019: {region: 0x9e, script: 0x57, flags: 0x0},
-	1020: {region: 0x9c, script: 0x5, flags: 0x0},
-	1021: {region: 0xda, script: 0x57, flags: 0x0},
-	1022: {region: 0x4f, script: 0x57, flags: 0x0},
-	1023: {region: 0xd1, script: 0x57, flags: 0x0},
-	1024: {region: 0xcf, script: 0x57, flags: 0x0},
-	1025: {region: 0xc3, script: 0x57, flags: 0x0},
-	1026: {region: 0x4c, script: 0x57, flags: 0x0},
-	1027: {region: 0x96, script: 0x7a, flags: 0x0},
-	1028: {region: 0xb6, script: 0x57, flags: 0x0},
-	1029: {region: 0x165, script: 0x29, flags: 0x0},
-	1030: {region: 0x165, script: 0x57, flags: 0x0},
-	1032: {region: 0xba, script: 0xdc, flags: 0x0},
-	1033: {region: 0x165, script: 0x57, flags: 0x0},
-	1034: {region: 0xc4, script: 0x72, flags: 0x0},
-	1035: {region: 0x165, script: 0x5, flags: 0x0},
-	1036: {region: 0xb3, script: 0xca, flags: 0x0},
-	1037: {region: 0x6f, script: 0x57, flags: 0x0},
-	1038: {region: 0x165, script: 0x57, flags: 0x0},
-	1039: {region: 0x165, script: 0x57, flags: 0x0},
-	1040: {region: 0x165, script: 0x57, flags: 0x0},
-	1041: {region: 0x165, script: 0x57, flags: 0x0},
-	1042: {region: 0x111, script: 0x57, flags: 0x0},
-	1043: {region: 0x165, script: 0x57, flags: 0x0},
-	1044: {region: 0xe8, script: 0x5, flags: 0x0},
-	1045: {region: 0x165, script: 0x57, flags: 0x0},
-	1046: {region: 0x10f, script: 0x57, flags: 0x0},
-	1047: {region: 0x165, script: 0x57, flags: 0x0},
-	1048: {region: 0xe9, script: 0x57, flags: 0x0},
-	1049: {region: 0x165, script: 0x57, flags: 0x0},
-	1050: {region: 0x95, script: 0x57, flags: 0x0},
-	1051: {region: 0x142, script: 0x57, flags: 0x0},
-	1052: {region: 0x10c, script: 0x57, flags: 0x0},
-	1054: {region: 0x10c, script: 0x57, flags: 0x0},
-	1055: {region: 0x72, script: 0x57, flags: 0x0},
-	1056: {region: 0x97, script: 0xc0, flags: 0x0},
-	1057: {region: 0x165, script: 0x57, flags: 0x0},
-	1058: {region: 0x72, script: 0x57, flags: 0x0},
-	1059: {region: 0x164, script: 0x57, flags: 0x0},
-	1060: {region: 0x165, script: 0x57, flags: 0x0},
-	1061: {region: 0xc3, script: 0x57, flags: 0x0},
-	1062: {region: 0x165, script: 0x57, flags: 0x0},
-	1063: {region: 0x165, script: 0x57, flags: 0x0},
-	1064: {region: 0x165, script: 0x57, flags: 0x0},
-	1065: {region: 0x115, script: 0x57, flags: 0x0},
-	1066: {region: 0x165, script: 0x57, flags: 0x0},
-	1067: {region: 0x165, script: 0x57, flags: 0x0},
-	1068: {region: 0x123, script: 0xdf, flags: 0x0},
-	1069: {region: 0x165, script: 0x57, flags: 0x0},
-	1070: {region: 0x165, script: 0x57, flags: 0x0},
-	1071: {region: 0x165, script: 0x57, flags: 0x0},
-	1072: {region: 0x165, script: 0x57, flags: 0x0},
-	1073: {region: 0x27, script: 0x57, flags: 0x0},
-	1074: {region: 0x37, script: 0x5, flags: 0x1},
-	1075: {region: 0x99, script: 0xcb, flags: 0x0},
-	1076: {region: 0x116, script: 0x57, flags: 0x0},
-	1077: {region: 0x114, script: 0x57, flags: 0x0},
-	1078: {region: 0x99, script: 0x21, flags: 0x0},
-	1079: {region: 0x161, script: 0x57, flags: 0x0},
-	1080: {region: 0x165, script: 0x57, flags: 0x0},
-	1081: {region: 0x165, script: 0x57, flags: 0x0},
-	1082: {region: 0x6d, script: 0x57, flags: 0x0},
-	1083: {region: 0x161, script: 0x57, flags: 0x0},
-	1084: {region: 0x165, script: 0x57, flags: 0x0},
-	1085: {region: 0x60, script: 0x57, flags: 0x0},
-	1086: {region: 0x95, script: 0x57, flags: 0x0},
-	1087: {region: 0x165, script: 0x57, flags: 0x0},
-	1088: {region: 0x165, script: 0x57, flags: 0x0},
-	1089: {region: 0x12f, script: 0x57, flags: 0x0},
-	1090: {region: 0x165, script: 0x57, flags: 0x0},
-	1091: {region: 0x84, script: 0x57, flags: 0x0},
-	1092: {region: 0x10c, script: 0x57, flags: 0x0},
-	1093: {region: 0x12f, script: 0x57, flags: 0x0},
-	1094: {region: 0x15f, script: 0x5, flags: 0x0},
-	1095: {region: 0x4b, script: 0x57, flags: 0x0},
-	1096: {region: 0x60, script: 0x57, flags: 0x0},
-	1097: {region: 0x165, script: 0x57, flags: 0x0},
-	1098: {region: 0x99, script: 0x21, flags: 0x0},
-	1099: {region: 0x95, script: 0x57, flags: 0x0},
-	1100: {region: 0x165, script: 0x57, flags: 0x0},
-	1101: {region: 0x35, script: 0xe, flags: 0x0},
-	1102: {region: 0x9b, script: 0xcf, flags: 0x0},
-	1103: {region: 0xe9, script: 0x57, flags: 0x0},
-	1104: {region: 0x99, script: 0xd7, flags: 0x0},
-	1105: {region: 0xdb, script: 0x21, flags: 0x0},
-	1106: {region: 0x165, script: 0x57, flags: 0x0},
-	1107: {region: 0x165, script: 0x57, flags: 0x0},
-	1108: {region: 0x165, script: 0x57, flags: 0x0},
-	1109: {region: 0x165, script: 0x57, flags: 0x0},
-	1110: {region: 0x165, script: 0x57, flags: 0x0},
-	1111: {region: 0x165, script: 0x57, flags: 0x0},
-	1112: {region: 0x165, script: 0x57, flags: 0x0},
-	1113: {region: 0x165, script: 0x57, flags: 0x0},
-	1114: {region: 0xe7, script: 0x57, flags: 0x0},
-	1115: {region: 0x165, script: 0x57, flags: 0x0},
-	1116: {region: 0x165, script: 0x57, flags: 0x0},
-	1117: {region: 0x99, script: 0x4f, flags: 0x0},
-	1118: {region: 0x53, script: 0xd5, flags: 0x0},
-	1119: {region: 0xdb, script: 0x21, flags: 0x0},
-	1120: {region: 0xdb, script: 0x21, flags: 0x0},
-	1121: {region: 0x99, script: 0xda, flags: 0x0},
-	1122: {region: 0x165, script: 0x57, flags: 0x0},
-	1123: {region: 0x112, script: 0x57, flags: 0x0},
-	1124: {region: 0x131, script: 0x57, flags: 0x0},
-	1125: {region: 0x126, script: 0x57, flags: 0x0},
-	1126: {region: 0x165, script: 0x57, flags: 0x0},
-	1127: {region: 0x3c, script: 0x3, flags: 0x1},
-	1128: {region: 0x165, script: 0x57, flags: 0x0},
-	1129: {region: 0x165, script: 0x57, flags: 0x0},
-	1130: {region: 0x165, script: 0x57, flags: 0x0},
-	1131: {region: 0x123, script: 0xdf, flags: 0x0},
-	1132: {region: 0xdb, script: 0x21, flags: 0x0},
-	1133: {region: 0xdb, script: 0x21, flags: 0x0},
-	1134: {region: 0xdb, script: 0x21, flags: 0x0},
-	1135: {region: 0x6f, script: 0x29, flags: 0x0},
-	1136: {region: 0x165, script: 0x57, flags: 0x0},
-	1137: {region: 0x6d, script: 0x29, flags: 0x0},
-	1138: {region: 0x165, script: 0x57, flags: 0x0},
-	1139: {region: 0x165, script: 0x57, flags: 0x0},
-	1140: {region: 0x165, script: 0x57, flags: 0x0},
-	1141: {region: 0xd6, script: 0x57, flags: 0x0},
-	1142: {region: 0x127, script: 0x57, flags: 0x0},
-	1143: {region: 0x125, script: 0x57, flags: 0x0},
-	1144: {region: 0x32, script: 0x57, flags: 0x0},
-	1145: {region: 0xdb, script: 0x21, flags: 0x0},
-	1146: {region: 0xe7, script: 0x57, flags: 0x0},
-	1147: {region: 0x165, script: 0x57, flags: 0x0},
-	1148: {region: 0x165, script: 0x57, flags: 0x0},
-	1149: {region: 0x32, script: 0x57, flags: 0x0},
-	1150: {region: 0xd4, script: 0x57, flags: 0x0},
-	1151: {region: 0x165, script: 0x57, flags: 0x0},
-	1152: {region: 0x161, script: 0x57, flags: 0x0},
-	1153: {region: 0x165, script: 0x57, flags: 0x0},
-	1154: {region: 0x129, script: 0x57, flags: 0x0},
-	1155: {region: 0x165, script: 0x57, flags: 0x0},
-	1156: {region: 0xce, script: 0x57, flags: 0x0},
-	1157: {region: 0x165, script: 0x57, flags: 0x0},
-	1158: {region: 0xe6, script: 0x57, flags: 0x0},
-	1159: {region: 0x165, script: 0x57, flags: 0x0},
-	1160: {region: 0x165, script: 0x57, flags: 0x0},
-	1161: {region: 0x165, script: 0x57, flags: 0x0},
-	1162: {region: 0x12b, script: 0x57, flags: 0x0},
-	1163: {region: 0x12b, script: 0x57, flags: 0x0},
-	1164: {region: 0x12e, script: 0x57, flags: 0x0},
-	1165: {region: 0x165, script: 0x5, flags: 0x0},
-	1166: {region: 0x161, script: 0x57, flags: 0x0},
-	1167: {region: 0x87, script: 0x31, flags: 0x0},
-	1168: {region: 0xdb, script: 0x21, flags: 0x0},
-	1169: {region: 0xe7, script: 0x57, flags: 0x0},
-	1170: {region: 0x43, script: 0xe0, flags: 0x0},
-	1171: {region: 0x165, script: 0x57, flags: 0x0},
-	1172: {region: 0x106, script: 0x1f, flags: 0x0},
-	1173: {region: 0x165, script: 0x57, flags: 0x0},
-	1174: {region: 0x165, script: 0x57, flags: 0x0},
-	1175: {region: 0x131, script: 0x57, flags: 0x0},
-	1176: {region: 0x165, script: 0x57, flags: 0x0},
-	1177: {region: 0x123, script: 0xdf, flags: 0x0},
-	1178: {region: 0x32, script: 0x57, flags: 0x0},
-	1179: {region: 0x165, script: 0x57, flags: 0x0},
-	1180: {region: 0x165, script: 0x57, flags: 0x0},
-	1181: {region: 0xce, script: 0x57, flags: 0x0},
-	1182: {region: 0x165, script: 0x57, flags: 0x0},
-	1183: {region: 0x165, script: 0x57, flags: 0x0},
-	1184: {region: 0x12d, script: 0x57, flags: 0x0},
-	1185: {region: 0x165, script: 0x57, flags: 0x0},
-	1187: {region: 0x165, script: 0x57, flags: 0x0},
-	1188: {region: 0xd4, script: 0x57, flags: 0x0},
-	1189: {region: 0x53, script: 0xd8, flags: 0x0},
-	1190: {region: 0xe5, script: 0x57, flags: 0x0},
-	1191: {region: 0x165, script: 0x57, flags: 0x0},
-	1192: {region: 0x106, script: 0x1f, flags: 0x0},
-	1193: {region: 0xba, script: 0x57, flags: 0x0},
-	1194: {region: 0x165, script: 0x57, flags: 0x0},
-	1195: {region: 0x106, script: 0x1f, flags: 0x0},
-	1196: {region: 0x3f, script: 0x4, flags: 0x1},
-	1197: {region: 0x11c, script: 0xe2, flags: 0x0},
-	1198: {region: 0x130, script: 0x1f, flags: 0x0},
-	1199: {region: 0x75, script: 0x57, flags: 0x0},
-	1200: {region: 0x2a, script: 0x57, flags: 0x0},
-	1202: {region: 0x43, script: 0x3, flags: 0x1},
-	1203: {region: 0x99, script: 0xe, flags: 0x0},
-	1204: {region: 0xe8, script: 0x5, flags: 0x0},
-	1205: {region: 0x165, script: 0x57, flags: 0x0},
-	1206: {region: 0x165, script: 0x57, flags: 0x0},
-	1207: {region: 0x165, script: 0x57, flags: 0x0},
-	1208: {region: 0x165, script: 0x57, flags: 0x0},
-	1209: {region: 0x165, script: 0x57, flags: 0x0},
-	1210: {region: 0x165, script: 0x57, flags: 0x0},
-	1211: {region: 0x165, script: 0x57, flags: 0x0},
-	1212: {region: 0x46, script: 0x4, flags: 0x1},
-	1213: {region: 0x165, script: 0x57, flags: 0x0},
-	1214: {region: 0xb4, script: 0xe3, flags: 0x0},
-	1215: {region: 0x165, script: 0x57, flags: 0x0},
-	1216: {region: 0x161, script: 0x57, flags: 0x0},
-	1217: {region: 0x9e, script: 0x57, flags: 0x0},
-	1218: {region: 0x106, script: 0x57, flags: 0x0},
-	1219: {region: 0x13e, script: 0x57, flags: 0x0},
-	1220: {region: 0x11b, script: 0x57, flags: 0x0},
-	1221: {region: 0x165, script: 0x57, flags: 0x0},
-	1222: {region: 0x36, script: 0x57, flags: 0x0},
-	1223: {region: 0x60, script: 0x57, flags: 0x0},
-	1224: {region: 0xd1, script: 0x57, flags: 0x0},
-	1225: {region: 0x1, script: 0x57, flags: 0x0},
-	1226: {region: 0x106, script: 0x57, flags: 0x0},
-	1227: {region: 0x6a, script: 0x57, flags: 0x0},
-	1228: {region: 0x12f, script: 0x57, flags: 0x0},
-	1229: {region: 0x165, script: 0x57, flags: 0x0},
-	1230: {region: 0x36, script: 0x57, flags: 0x0},
-	1231: {region: 0x4e, script: 0x57, flags: 0x0},
-	1232: {region: 0x165, script: 0x57, flags: 0x0},
-	1233: {region: 0x6f, script: 0x29, flags: 0x0},
-	1234: {region: 0x165, script: 0x57, flags: 0x0},
-	1235: {region: 0xe7, script: 0x57, flags: 0x0},
-	1236: {region: 0x2f, script: 0x57, flags: 0x0},
-	1237: {region: 0x99, script: 0xda, flags: 0x0},
-	1238: {region: 0x99, script: 0x21, flags: 0x0},
-	1239: {region: 0x165, script: 0x57, flags: 0x0},
-	1240: {region: 0x165, script: 0x57, flags: 0x0},
-	1241: {region: 0x165, script: 0x57, flags: 0x0},
-	1242: {region: 0x165, script: 0x57, flags: 0x0},
-	1243: {region: 0x165, script: 0x57, flags: 0x0},
-	1244: {region: 0x165, script: 0x57, flags: 0x0},
-	1245: {region: 0x165, script: 0x57, flags: 0x0},
-	1246: {region: 0x165, script: 0x57, flags: 0x0},
-	1247: {region: 0x165, script: 0x57, flags: 0x0},
-	1248: {region: 0x140, script: 0x57, flags: 0x0},
-	1249: {region: 0x165, script: 0x57, flags: 0x0},
-	1250: {region: 0x165, script: 0x57, flags: 0x0},
-	1251: {region: 0xa8, script: 0x5, flags: 0x0},
-	1252: {region: 0x165, script: 0x57, flags: 0x0},
-	1253: {region: 0x114, script: 0x57, flags: 0x0},
-	1254: {region: 0x165, script: 0x57, flags: 0x0},
-	1255: {region: 0x165, script: 0x57, flags: 0x0},
-	1256: {region: 0x165, script: 0x57, flags: 0x0},
-	1257: {region: 0x165, script: 0x57, flags: 0x0},
-	1258: {region: 0x99, script: 0x21, flags: 0x0},
-	1259: {region: 0x53, script: 0x38, flags: 0x0},
-	1260: {region: 0x165, script: 0x57, flags: 0x0},
-	1261: {region: 0x165, script: 0x57, flags: 0x0},
-	1262: {region: 0x41, script: 0x57, flags: 0x0},
-	1263: {region: 0x165, script: 0x57, flags: 0x0},
-	1264: {region: 0x12b, script: 0x18, flags: 0x0},
-	1265: {region: 0x165, script: 0x57, flags: 0x0},
-	1266: {region: 0x161, script: 0x57, flags: 0x0},
-	1267: {region: 0x165, script: 0x57, flags: 0x0},
-	1268: {region: 0x12b, script: 0x5f, flags: 0x0},
-	1269: {region: 0x12b, script: 0x60, flags: 0x0},
-	1270: {region: 0x7d, script: 0x2b, flags: 0x0},
-	1271: {region: 0x53, script: 0x64, flags: 0x0},
-	1272: {region: 0x10b, script: 0x69, flags: 0x0},
-	1273: {region: 0x108, script: 0x73, flags: 0x0},
-	1274: {region: 0x99, script: 0x21, flags: 0x0},
-	1275: {region: 0x131, script: 0x57, flags: 0x0},
-	1276: {region: 0x165, script: 0x57, flags: 0x0},
-	1277: {region: 0x9c, script: 0x8a, flags: 0x0},
-	1278: {region: 0x165, script: 0x57, flags: 0x0},
-	1279: {region: 0x15e, script: 0xc2, flags: 0x0},
-	1280: {region: 0x165, script: 0x57, flags: 0x0},
-	1281: {region: 0x165, script: 0x57, flags: 0x0},
-	1282: {region: 0xdb, script: 0x21, flags: 0x0},
-	1283: {region: 0x165, script: 0x57, flags: 0x0},
-	1284: {region: 0x165, script: 0x57, flags: 0x0},
-	1285: {region: 0xd1, script: 0x57, flags: 0x0},
-	1286: {region: 0x75, script: 0x57, flags: 0x0},
-	1287: {region: 0x165, script: 0x57, flags: 0x0},
-	1288: {region: 0x165, script: 0x57, flags: 0x0},
-	1289: {region: 0x52, script: 0x57, flags: 0x0},
-	1290: {region: 0x165, script: 0x57, flags: 0x0},
-	1291: {region: 0x165, script: 0x57, flags: 0x0},
-	1292: {region: 0x165, script: 0x57, flags: 0x0},
-	1293: {region: 0x52, script: 0x57, flags: 0x0},
-	1294: {region: 0x165, script: 0x57, flags: 0x0},
-	1295: {region: 0x165, script: 0x57, flags: 0x0},
-	1296: {region: 0x165, script: 0x57, flags: 0x0},
-	1297: {region: 0x165, script: 0x57, flags: 0x0},
-	1298: {region: 0x1, script: 0x3b, flags: 0x0},
-	1299: {region: 0x165, script: 0x57, flags: 0x0},
-	1300: {region: 0x165, script: 0x57, flags: 0x0},
-	1301: {region: 0x165, script: 0x57, flags: 0x0},
-	1302: {region: 0x165, script: 0x57, flags: 0x0},
-	1303: {region: 0x165, script: 0x57, flags: 0x0},
-	1304: {region: 0xd6, script: 0x57, flags: 0x0},
-	1305: {region: 0x165, script: 0x57, flags: 0x0},
-	1306: {region: 0x165, script: 0x57, flags: 0x0},
-	1307: {region: 0x165, script: 0x57, flags: 0x0},
-	1308: {region: 0x41, script: 0x57, flags: 0x0},
-	1309: {region: 0x165, script: 0x57, flags: 0x0},
-	1310: {region: 0xcf, script: 0x57, flags: 0x0},
-	1311: {region: 0x4a, script: 0x3, flags: 0x1},
-	1312: {region: 0x165, script: 0x57, flags: 0x0},
-	1313: {region: 0x165, script: 0x57, flags: 0x0},
-	1314: {region: 0x165, script: 0x57, flags: 0x0},
-	1315: {region: 0x53, script: 0x57, flags: 0x0},
-	1316: {region: 0x10b, script: 0x57, flags: 0x0},
-	1318: {region: 0xa8, script: 0x5, flags: 0x0},
-	1319: {region: 0xd9, script: 0x57, flags: 0x0},
-	1320: {region: 0xba, script: 0xdc, flags: 0x0},
-	1321: {region: 0x4d, script: 0x14, flags: 0x1},
-	1322: {region: 0x53, script: 0x79, flags: 0x0},
-	1323: {region: 0x165, script: 0x57, flags: 0x0},
-	1324: {region: 0x122, script: 0x57, flags: 0x0},
-	1325: {region: 0xd0, script: 0x57, flags: 0x0},
-	1326: {region: 0x165, script: 0x57, flags: 0x0},
-	1327: {region: 0x161, script: 0x57, flags: 0x0},
-	1329: {region: 0x12b, script: 0x57, flags: 0x0},
-}
-
-// likelyLangList holds lists info associated with likelyLang.
-// Size: 388 bytes, 97 elements
-var likelyLangList = [97]likelyScriptRegion{
-	0:  {region: 0x9c, script: 0x7, flags: 0x0},
-	1:  {region: 0xa1, script: 0x74, flags: 0x2},
-	2:  {region: 0x11c, script: 0x80, flags: 0x2},
-	3:  {region: 0x32, script: 0x57, flags: 0x0},
-	4:  {region: 0x9b, script: 0x5, flags: 0x4},
-	5:  {region: 0x9c, script: 0x5, flags: 0x4},
-	6:  {region: 0x106, script: 0x1f, flags: 0x4},
-	7:  {region: 0x9c, script: 0x5, flags: 0x2},
-	8:  {region: 0x106, script: 0x1f, flags: 0x0},
-	9:  {region: 0x38, script: 0x2c, flags: 0x2},
-	10: {region: 0x135, script: 0x57, flags: 0x0},
-	11: {region: 0x7b, script: 0xc5, flags: 0x2},
-	12: {region: 0x114, script: 0x57, flags: 0x0},
-	13: {region: 0x84, script: 0x1, flags: 0x2},
-	14: {region: 0x5d, script: 0x1e, flags: 0x0},
-	15: {region: 0x87, script: 0x5c, flags: 0x2},
-	16: {region: 0xd6, script: 0x57, flags: 0x0},
-	17: {region: 0x52, script: 0x5, flags: 0x4},
-	18: {region: 0x10b, script: 0x5, flags: 0x4},
-	19: {region: 0xae, script: 0x1f, flags: 0x0},
-	20: {region: 0x24, script: 0x5, flags: 0x4},
-	21: {region: 0x53, script: 0x5, flags: 0x4},
-	22: {region: 0x9c, script: 0x5, flags: 0x4},
-	23: {region: 0xc5, script: 0x5, flags: 0x4},
-	24: {region: 0x53, script: 0x5, flags: 0x2},
-	25: {region: 0x12b, script: 0x57, flags: 0x0},
-	26: {region: 0xb0, script: 0x5, flags: 0x4},
-	27: {region: 0x9b, script: 0x5, flags: 0x2},
-	28: {region: 0xa5, script: 0x1f, flags: 0x0},
-	29: {region: 0x53, script: 0x5, flags: 0x4},
-	30: {region: 0x12b, script: 0x57, flags: 0x4},
-	31: {region: 0x53, script: 0x5, flags: 0x2},
-	32: {region: 0x12b, script: 0x57, flags: 0x2},
-	33: {region: 0xdb, script: 0x21, flags: 0x0},
-	34: {region: 0x99, script: 0x5a, flags: 0x2},
-	35: {region: 0x83, script: 0x57, flags: 0x0},
-	36: {region: 0x84, script: 0x78, flags: 0x4},
-	37: {region: 0x84, script: 0x78, flags: 0x2},
-	38: {region: 0xc5, script: 0x1f, flags: 0x0},
-	39: {region: 0x53, script: 0x6d, flags: 0x4},
-	40: {region: 0x53, script: 0x6d, flags: 0x2},
-	41: {region: 0xd0, script: 0x57, flags: 0x0},
-	42: {region: 0x4a, script: 0x5, flags: 0x4},
-	43: {region: 0x95, script: 0x5, flags: 0x4},
-	44: {region: 0x99, script: 0x33, flags: 0x0},
-	45: {region: 0xe8, script: 0x5, flags: 0x4},
-	46: {region: 0xe8, script: 0x5, flags: 0x2},
-	47: {region: 0x9c, script: 0x84, flags: 0x0},
-	48: {region: 0x53, script: 0x85, flags: 0x2},
-	49: {region: 0xba, script: 0xdc, flags: 0x0},
-	50: {region: 0xd9, script: 0x57, flags: 0x4},
-	51: {region: 0xe8, script: 0x5, flags: 0x0},
-	52: {region: 0x99, script: 0x21, flags: 0x2},
-	53: {region: 0x99, script: 0x4c, flags: 0x2},
-	54: {region: 0x99, script: 0xc9, flags: 0x2},
-	55: {region: 0x105, script: 0x1f, flags: 0x0},
-	56: {region: 0xbd, script: 0x57, flags: 0x4},
-	57: {region: 0x104, script: 0x57, flags: 0x4},
-	58: {region: 0x106, script: 0x57, flags: 0x4},
-	59: {region: 0x12b, script: 0x57, flags: 0x4},
-	60: {region: 0x124, script: 0x1f, flags: 0x0},
-	61: {region: 0xe8, script: 0x5, flags: 0x4},
-	62: {region: 0xe8, script: 0x5, flags: 0x2},
-	63: {region: 0x53, script: 0x5, flags: 0x0},
-	64: {region: 0xae, script: 0x1f, flags: 0x4},
-	65: {region: 0xc5, script: 0x1f, flags: 0x4},
-	66: {region: 0xae, script: 0x1f, flags: 0x2},
-	67: {region: 0x99, script: 0xe, flags: 0x0},
-	68: {region: 0xdb, script: 0x21, flags: 0x4},
-	69: {region: 0xdb, script: 0x21, flags: 0x2},
-	70: {region: 0x137, script: 0x57, flags: 0x0},
-	71: {region: 0x24, script: 0x5, flags: 0x4},
-	72: {region: 0x53, script: 0x1f, flags: 0x4},
-	73: {region: 0x24, script: 0x5, flags: 0x2},
-	74: {region: 0x8d, script: 0x39, flags: 0x0},
-	75: {region: 0x53, script: 0x38, flags: 0x4},
-	76: {region: 0x53, script: 0x38, flags: 0x2},
-	77: {region: 0x53, script: 0x38, flags: 0x0},
-	78: {region: 0x2f, script: 0x39, flags: 0x4},
-	79: {region: 0x3e, script: 0x39, flags: 0x4},
-	80: {region: 0x7b, script: 0x39, flags: 0x4},
-	81: {region: 0x7e, script: 0x39, flags: 0x4},
-	82: {region: 0x8d, script: 0x39, flags: 0x4},
-	83: {region: 0x95, script: 0x39, flags: 0x4},
-	84: {region: 0xc6, script: 0x39, flags: 0x4},
-	85: {region: 0xd0, script: 0x39, flags: 0x4},
-	86: {region: 0xe2, script: 0x39, flags: 0x4},
-	87: {region: 0xe5, script: 0x39, flags: 0x4},
-	88: {region: 0xe7, script: 0x39, flags: 0x4},
-	89: {region: 0x116, script: 0x39, flags: 0x4},
-	90: {region: 0x123, script: 0x39, flags: 0x4},
-	91: {region: 0x12e, script: 0x39, flags: 0x4},
-	92: {region: 0x135, script: 0x39, flags: 0x4},
-	93: {region: 0x13e, script: 0x39, flags: 0x4},
-	94: {region: 0x12e, script: 0x11, flags: 0x2},
-	95: {region: 0x12e, script: 0x34, flags: 0x2},
-	96: {region: 0x12e, script: 0x39, flags: 0x2},
-}
-
-type likelyLangScript struct {
-	lang   uint16
-	script uint8
-	flags  uint8
-}
-
-// likelyRegion is a lookup table, indexed by regionID, for the most likely
-// languages and scripts given incomplete information. If more entries exist
-// for a given regionID, lang and script are the index and size respectively
-// of the list in likelyRegionList.
-// TODO: exclude containers and user-definable regions from the list.
-// Size: 1432 bytes, 358 elements
-var likelyRegion = [358]likelyLangScript{
-	34:  {lang: 0xd7, script: 0x57, flags: 0x0},
-	35:  {lang: 0x3a, script: 0x5, flags: 0x0},
-	36:  {lang: 0x0, script: 0x2, flags: 0x1},
-	39:  {lang: 0x2, script: 0x2, flags: 0x1},
-	40:  {lang: 0x4, script: 0x2, flags: 0x1},
-	42:  {lang: 0x3c0, script: 0x57, flags: 0x0},
-	43:  {lang: 0x0, script: 0x57, flags: 0x0},
-	44:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	45:  {lang: 0x41b, script: 0x57, flags: 0x0},
-	46:  {lang: 0x10d, script: 0x57, flags: 0x0},
-	48:  {lang: 0x367, script: 0x57, flags: 0x0},
-	49:  {lang: 0x444, script: 0x57, flags: 0x0},
-	50:  {lang: 0x58, script: 0x57, flags: 0x0},
-	51:  {lang: 0x6, script: 0x2, flags: 0x1},
-	53:  {lang: 0xa5, script: 0xe, flags: 0x0},
-	54:  {lang: 0x367, script: 0x57, flags: 0x0},
-	55:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	56:  {lang: 0x7e, script: 0x1f, flags: 0x0},
-	57:  {lang: 0x3a, script: 0x5, flags: 0x0},
-	58:  {lang: 0x3d9, script: 0x57, flags: 0x0},
-	59:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	60:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	62:  {lang: 0x31f, script: 0x57, flags: 0x0},
-	63:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	64:  {lang: 0x3a1, script: 0x57, flags: 0x0},
-	65:  {lang: 0x3c0, script: 0x57, flags: 0x0},
-	67:  {lang: 0x8, script: 0x2, flags: 0x1},
-	69:  {lang: 0x0, script: 0x57, flags: 0x0},
-	71:  {lang: 0x71, script: 0x1f, flags: 0x0},
-	73:  {lang: 0x512, script: 0x3b, flags: 0x2},
-	74:  {lang: 0x31f, script: 0x5, flags: 0x2},
-	75:  {lang: 0x445, script: 0x57, flags: 0x0},
-	76:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	77:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	78:  {lang: 0x10d, script: 0x57, flags: 0x0},
-	79:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	81:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	82:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	83:  {lang: 0xa, script: 0x4, flags: 0x1},
-	84:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	85:  {lang: 0x0, script: 0x57, flags: 0x0},
-	86:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	89:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	90:  {lang: 0x3c0, script: 0x57, flags: 0x0},
-	91:  {lang: 0x3a1, script: 0x57, flags: 0x0},
-	93:  {lang: 0xe, script: 0x2, flags: 0x1},
-	94:  {lang: 0xfa, script: 0x57, flags: 0x0},
-	96:  {lang: 0x10d, script: 0x57, flags: 0x0},
-	98:  {lang: 0x1, script: 0x57, flags: 0x0},
-	99:  {lang: 0x101, script: 0x57, flags: 0x0},
-	101: {lang: 0x13e, script: 0x57, flags: 0x0},
-	103: {lang: 0x10, script: 0x2, flags: 0x1},
-	104: {lang: 0x13e, script: 0x57, flags: 0x0},
-	105: {lang: 0x13e, script: 0x57, flags: 0x0},
-	106: {lang: 0x140, script: 0x57, flags: 0x0},
-	107: {lang: 0x3a, script: 0x5, flags: 0x0},
-	108: {lang: 0x3a, script: 0x5, flags: 0x0},
-	109: {lang: 0x46f, script: 0x29, flags: 0x0},
-	110: {lang: 0x13e, script: 0x57, flags: 0x0},
-	111: {lang: 0x12, script: 0x2, flags: 0x1},
-	113: {lang: 0x10d, script: 0x57, flags: 0x0},
-	114: {lang: 0x151, script: 0x57, flags: 0x0},
-	115: {lang: 0x1c0, script: 0x21, flags: 0x2},
-	118: {lang: 0x158, script: 0x57, flags: 0x0},
-	120: {lang: 0x15e, script: 0x57, flags: 0x0},
-	122: {lang: 0x15e, script: 0x57, flags: 0x0},
-	123: {lang: 0x14, script: 0x2, flags: 0x1},
-	125: {lang: 0x16, script: 0x3, flags: 0x1},
-	126: {lang: 0x15e, script: 0x57, flags: 0x0},
-	128: {lang: 0x21, script: 0x57, flags: 0x0},
-	130: {lang: 0x245, script: 0x57, flags: 0x0},
-	132: {lang: 0x15e, script: 0x57, flags: 0x0},
-	133: {lang: 0x15e, script: 0x57, flags: 0x0},
-	134: {lang: 0x13e, script: 0x57, flags: 0x0},
-	135: {lang: 0x19, script: 0x2, flags: 0x1},
-	136: {lang: 0x0, script: 0x57, flags: 0x0},
-	137: {lang: 0x13e, script: 0x57, flags: 0x0},
-	139: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	141: {lang: 0x529, script: 0x39, flags: 0x0},
-	142: {lang: 0x0, script: 0x57, flags: 0x0},
-	143: {lang: 0x13e, script: 0x57, flags: 0x0},
-	144: {lang: 0x1d1, script: 0x57, flags: 0x0},
-	145: {lang: 0x1d4, script: 0x57, flags: 0x0},
-	146: {lang: 0x1d5, script: 0x57, flags: 0x0},
-	148: {lang: 0x13e, script: 0x57, flags: 0x0},
-	149: {lang: 0x1b, script: 0x2, flags: 0x1},
-	151: {lang: 0x1bc, script: 0x3b, flags: 0x0},
-	153: {lang: 0x1d, script: 0x3, flags: 0x1},
-	155: {lang: 0x3a, script: 0x5, flags: 0x0},
-	156: {lang: 0x20, script: 0x2, flags: 0x1},
-	157: {lang: 0x1f8, script: 0x57, flags: 0x0},
-	158: {lang: 0x1f9, script: 0x57, flags: 0x0},
-	161: {lang: 0x3a, script: 0x5, flags: 0x0},
-	162: {lang: 0x200, script: 0x46, flags: 0x0},
-	164: {lang: 0x445, script: 0x57, flags: 0x0},
-	165: {lang: 0x28a, script: 0x1f, flags: 0x0},
-	166: {lang: 0x22, script: 0x3, flags: 0x1},
-	168: {lang: 0x25, script: 0x2, flags: 0x1},
-	170: {lang: 0x254, script: 0x50, flags: 0x0},
-	171: {lang: 0x254, script: 0x50, flags: 0x0},
-	172: {lang: 0x3a, script: 0x5, flags: 0x0},
-	174: {lang: 0x3e2, script: 0x1f, flags: 0x0},
-	175: {lang: 0x27, script: 0x2, flags: 0x1},
-	176: {lang: 0x3a, script: 0x5, flags: 0x0},
-	178: {lang: 0x10d, script: 0x57, flags: 0x0},
-	179: {lang: 0x40c, script: 0xca, flags: 0x0},
-	181: {lang: 0x43b, script: 0x57, flags: 0x0},
-	182: {lang: 0x2c0, script: 0x57, flags: 0x0},
-	183: {lang: 0x15e, script: 0x57, flags: 0x0},
-	184: {lang: 0x2c7, script: 0x57, flags: 0x0},
-	185: {lang: 0x3a, script: 0x5, flags: 0x0},
-	186: {lang: 0x29, script: 0x2, flags: 0x1},
-	187: {lang: 0x15e, script: 0x57, flags: 0x0},
-	188: {lang: 0x2b, script: 0x2, flags: 0x1},
-	189: {lang: 0x432, script: 0x57, flags: 0x0},
-	190: {lang: 0x15e, script: 0x57, flags: 0x0},
-	191: {lang: 0x2f1, script: 0x57, flags: 0x0},
-	194: {lang: 0x2d, script: 0x2, flags: 0x1},
-	195: {lang: 0xa0, script: 0x57, flags: 0x0},
-	196: {lang: 0x2f, script: 0x2, flags: 0x1},
-	197: {lang: 0x31, script: 0x2, flags: 0x1},
-	198: {lang: 0x33, script: 0x2, flags: 0x1},
-	200: {lang: 0x15e, script: 0x57, flags: 0x0},
-	201: {lang: 0x35, script: 0x2, flags: 0x1},
-	203: {lang: 0x320, script: 0x57, flags: 0x0},
-	204: {lang: 0x37, script: 0x3, flags: 0x1},
-	205: {lang: 0x128, script: 0xde, flags: 0x0},
-	207: {lang: 0x13e, script: 0x57, flags: 0x0},
-	208: {lang: 0x31f, script: 0x57, flags: 0x0},
-	209: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	210: {lang: 0x16, script: 0x57, flags: 0x0},
-	211: {lang: 0x15e, script: 0x57, flags: 0x0},
-	212: {lang: 0x1b4, script: 0x57, flags: 0x0},
-	214: {lang: 0x1b4, script: 0x5, flags: 0x2},
-	216: {lang: 0x13e, script: 0x57, flags: 0x0},
-	217: {lang: 0x367, script: 0x57, flags: 0x0},
-	218: {lang: 0x347, script: 0x57, flags: 0x0},
-	219: {lang: 0x351, script: 0x21, flags: 0x0},
-	225: {lang: 0x3a, script: 0x5, flags: 0x0},
-	226: {lang: 0x13e, script: 0x57, flags: 0x0},
-	228: {lang: 0x13e, script: 0x57, flags: 0x0},
-	229: {lang: 0x15e, script: 0x57, flags: 0x0},
-	230: {lang: 0x486, script: 0x57, flags: 0x0},
-	231: {lang: 0x153, script: 0x57, flags: 0x0},
-	232: {lang: 0x3a, script: 0x3, flags: 0x1},
-	233: {lang: 0x3b3, script: 0x57, flags: 0x0},
-	234: {lang: 0x15e, script: 0x57, flags: 0x0},
-	236: {lang: 0x13e, script: 0x57, flags: 0x0},
-	237: {lang: 0x3a, script: 0x5, flags: 0x0},
-	238: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	240: {lang: 0x3a2, script: 0x57, flags: 0x0},
-	241: {lang: 0x194, script: 0x57, flags: 0x0},
-	243: {lang: 0x3a, script: 0x5, flags: 0x0},
-	258: {lang: 0x15e, script: 0x57, flags: 0x0},
-	260: {lang: 0x3d, script: 0x2, flags: 0x1},
-	261: {lang: 0x432, script: 0x1f, flags: 0x0},
-	262: {lang: 0x3f, script: 0x2, flags: 0x1},
-	263: {lang: 0x3e5, script: 0x57, flags: 0x0},
-	264: {lang: 0x3a, script: 0x5, flags: 0x0},
-	266: {lang: 0x15e, script: 0x57, flags: 0x0},
-	267: {lang: 0x3a, script: 0x5, flags: 0x0},
-	268: {lang: 0x41, script: 0x2, flags: 0x1},
-	271: {lang: 0x416, script: 0x57, flags: 0x0},
-	272: {lang: 0x347, script: 0x57, flags: 0x0},
-	273: {lang: 0x43, script: 0x2, flags: 0x1},
-	275: {lang: 0x1f9, script: 0x57, flags: 0x0},
-	276: {lang: 0x15e, script: 0x57, flags: 0x0},
-	277: {lang: 0x429, script: 0x57, flags: 0x0},
-	278: {lang: 0x367, script: 0x57, flags: 0x0},
-	280: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	282: {lang: 0x13e, script: 0x57, flags: 0x0},
-	284: {lang: 0x45, script: 0x2, flags: 0x1},
-	288: {lang: 0x15e, script: 0x57, flags: 0x0},
-	289: {lang: 0x15e, script: 0x57, flags: 0x0},
-	290: {lang: 0x47, script: 0x2, flags: 0x1},
-	291: {lang: 0x49, script: 0x3, flags: 0x1},
-	292: {lang: 0x4c, script: 0x2, flags: 0x1},
-	293: {lang: 0x477, script: 0x57, flags: 0x0},
-	294: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	295: {lang: 0x476, script: 0x57, flags: 0x0},
-	296: {lang: 0x4e, script: 0x2, flags: 0x1},
-	297: {lang: 0x482, script: 0x57, flags: 0x0},
-	299: {lang: 0x50, script: 0x4, flags: 0x1},
-	301: {lang: 0x4a0, script: 0x57, flags: 0x0},
-	302: {lang: 0x54, script: 0x2, flags: 0x1},
-	303: {lang: 0x445, script: 0x57, flags: 0x0},
-	304: {lang: 0x56, script: 0x3, flags: 0x1},
-	305: {lang: 0x445, script: 0x57, flags: 0x0},
-	309: {lang: 0x512, script: 0x3b, flags: 0x2},
-	310: {lang: 0x13e, script: 0x57, flags: 0x0},
-	311: {lang: 0x4bc, script: 0x57, flags: 0x0},
-	312: {lang: 0x1f9, script: 0x57, flags: 0x0},
-	315: {lang: 0x13e, script: 0x57, flags: 0x0},
-	318: {lang: 0x4c3, script: 0x57, flags: 0x0},
-	319: {lang: 0x8a, script: 0x57, flags: 0x0},
-	320: {lang: 0x15e, script: 0x57, flags: 0x0},
-	322: {lang: 0x41b, script: 0x57, flags: 0x0},
-	333: {lang: 0x59, script: 0x2, flags: 0x1},
-	350: {lang: 0x3a, script: 0x5, flags: 0x0},
-	351: {lang: 0x5b, script: 0x2, flags: 0x1},
-	356: {lang: 0x423, script: 0x57, flags: 0x0},
-}
-
-// likelyRegionList holds lists info associated with likelyRegion.
-// Size: 372 bytes, 93 elements
-var likelyRegionList = [93]likelyLangScript{
-	0:  {lang: 0x148, script: 0x5, flags: 0x0},
-	1:  {lang: 0x476, script: 0x57, flags: 0x0},
-	2:  {lang: 0x431, script: 0x57, flags: 0x0},
-	3:  {lang: 0x2ff, script: 0x1f, flags: 0x0},
-	4:  {lang: 0x1d7, script: 0x8, flags: 0x0},
-	5:  {lang: 0x274, script: 0x57, flags: 0x0},
-	6:  {lang: 0xb7, script: 0x57, flags: 0x0},
-	7:  {lang: 0x432, script: 0x1f, flags: 0x0},
-	8:  {lang: 0x12d, script: 0xe0, flags: 0x0},
-	9:  {lang: 0x351, script: 0x21, flags: 0x0},
-	10: {lang: 0x529, script: 0x38, flags: 0x0},
-	11: {lang: 0x4ac, script: 0x5, flags: 0x0},
-	12: {lang: 0x523, script: 0x57, flags: 0x0},
-	13: {lang: 0x29a, script: 0xdf, flags: 0x0},
-	14: {lang: 0x136, script: 0x31, flags: 0x0},
-	15: {lang: 0x48a, script: 0x57, flags: 0x0},
-	16: {lang: 0x3a, script: 0x5, flags: 0x0},
-	17: {lang: 0x15e, script: 0x57, flags: 0x0},
-	18: {lang: 0x27, script: 0x29, flags: 0x0},
-	19: {lang: 0x139, script: 0x57, flags: 0x0},
-	20: {lang: 0x26a, script: 0x5, flags: 0x2},
-	21: {lang: 0x512, script: 0x3b, flags: 0x2},
-	22: {lang: 0x210, script: 0x2b, flags: 0x0},
-	23: {lang: 0x5, script: 0x1f, flags: 0x0},
-	24: {lang: 0x274, script: 0x57, flags: 0x0},
-	25: {lang: 0x136, script: 0x31, flags: 0x0},
-	26: {lang: 0x2ff, script: 0x1f, flags: 0x0},
-	27: {lang: 0x1e1, script: 0x57, flags: 0x0},
-	28: {lang: 0x31f, script: 0x5, flags: 0x0},
-	29: {lang: 0x1be, script: 0x21, flags: 0x0},
-	30: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	31: {lang: 0x236, script: 0x72, flags: 0x0},
-	32: {lang: 0x148, script: 0x5, flags: 0x0},
-	33: {lang: 0x476, script: 0x57, flags: 0x0},
-	34: {lang: 0x24a, script: 0x4b, flags: 0x0},
-	35: {lang: 0xe6, script: 0x5, flags: 0x0},
-	36: {lang: 0x226, script: 0xdf, flags: 0x0},
-	37: {lang: 0x3a, script: 0x5, flags: 0x0},
-	38: {lang: 0x15e, script: 0x57, flags: 0x0},
-	39: {lang: 0x2b8, script: 0x54, flags: 0x0},
-	40: {lang: 0x226, script: 0xdf, flags: 0x0},
-	41: {lang: 0x3a, script: 0x5, flags: 0x0},
-	42: {lang: 0x15e, script: 0x57, flags: 0x0},
-	43: {lang: 0x3dc, script: 0x57, flags: 0x0},
-	44: {lang: 0x4ae, script: 0x1f, flags: 0x0},
-	45: {lang: 0x2ff, script: 0x1f, flags: 0x0},
-	46: {lang: 0x431, script: 0x57, flags: 0x0},
-	47: {lang: 0x331, script: 0x72, flags: 0x0},
-	48: {lang: 0x213, script: 0x57, flags: 0x0},
-	49: {lang: 0x30b, script: 0x1f, flags: 0x0},
-	50: {lang: 0x242, script: 0x5, flags: 0x0},
-	51: {lang: 0x529, script: 0x39, flags: 0x0},
-	52: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	53: {lang: 0x3a, script: 0x5, flags: 0x0},
-	54: {lang: 0x15e, script: 0x57, flags: 0x0},
-	55: {lang: 0x2ed, script: 0x57, flags: 0x0},
-	56: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	57: {lang: 0x88, script: 0x21, flags: 0x0},
-	58: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	59: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	60: {lang: 0xbe, script: 0x21, flags: 0x0},
-	61: {lang: 0x3dc, script: 0x57, flags: 0x0},
-	62: {lang: 0x7e, script: 0x1f, flags: 0x0},
-	63: {lang: 0x3e2, script: 0x1f, flags: 0x0},
-	64: {lang: 0x267, script: 0x57, flags: 0x0},
-	65: {lang: 0x444, script: 0x57, flags: 0x0},
-	66: {lang: 0x512, script: 0x3b, flags: 0x0},
-	67: {lang: 0x412, script: 0x57, flags: 0x0},
-	68: {lang: 0x4ae, script: 0x1f, flags: 0x0},
-	69: {lang: 0x3a, script: 0x5, flags: 0x0},
-	70: {lang: 0x15e, script: 0x57, flags: 0x0},
-	71: {lang: 0x15e, script: 0x57, flags: 0x0},
-	72: {lang: 0x35, script: 0x5, flags: 0x0},
-	73: {lang: 0x46b, script: 0xdf, flags: 0x0},
-	74: {lang: 0x2ec, script: 0x5, flags: 0x0},
-	75: {lang: 0x30f, script: 0x72, flags: 0x0},
-	76: {lang: 0x467, script: 0x1f, flags: 0x0},
-	77: {lang: 0x148, script: 0x5, flags: 0x0},
-	78: {lang: 0x3a, script: 0x5, flags: 0x0},
-	79: {lang: 0x15e, script: 0x57, flags: 0x0},
-	80: {lang: 0x48a, script: 0x57, flags: 0x0},
-	81: {lang: 0x58, script: 0x5, flags: 0x0},
-	82: {lang: 0x219, script: 0x1f, flags: 0x0},
-	83: {lang: 0x81, script: 0x31, flags: 0x0},
-	84: {lang: 0x529, script: 0x39, flags: 0x0},
-	85: {lang: 0x48c, script: 0x57, flags: 0x0},
-	86: {lang: 0x4ae, script: 0x1f, flags: 0x0},
-	87: {lang: 0x512, script: 0x3b, flags: 0x0},
-	88: {lang: 0x3b3, script: 0x57, flags: 0x0},
-	89: {lang: 0x431, script: 0x57, flags: 0x0},
-	90: {lang: 0x432, script: 0x1f, flags: 0x0},
-	91: {lang: 0x15e, script: 0x57, flags: 0x0},
-	92: {lang: 0x446, script: 0x5, flags: 0x0},
-}
-
-type likelyTag struct {
-	lang   uint16
-	region uint16
-	script uint8
-}
-
-// Size: 198 bytes, 33 elements
-var likelyRegionGroup = [33]likelyTag{
-	1:  {lang: 0x139, region: 0xd6, script: 0x57},
-	2:  {lang: 0x139, region: 0x135, script: 0x57},
-	3:  {lang: 0x3c0, region: 0x41, script: 0x57},
-	4:  {lang: 0x139, region: 0x2f, script: 0x57},
-	5:  {lang: 0x139, region: 0xd6, script: 0x57},
-	6:  {lang: 0x13e, region: 0xcf, script: 0x57},
-	7:  {lang: 0x445, region: 0x12f, script: 0x57},
-	8:  {lang: 0x3a, region: 0x6b, script: 0x5},
-	9:  {lang: 0x445, region: 0x4b, script: 0x57},
-	10: {lang: 0x139, region: 0x161, script: 0x57},
-	11: {lang: 0x139, region: 0x135, script: 0x57},
-	12: {lang: 0x139, region: 0x135, script: 0x57},
-	13: {lang: 0x13e, region: 0x59, script: 0x57},
-	14: {lang: 0x529, region: 0x53, script: 0x38},
-	15: {lang: 0x1be, region: 0x99, script: 0x21},
-	16: {lang: 0x1e1, region: 0x95, script: 0x57},
-	17: {lang: 0x1f9, region: 0x9e, script: 0x57},
-	18: {lang: 0x139, region: 0x2f, script: 0x57},
-	19: {lang: 0x139, region: 0xe6, script: 0x57},
-	20: {lang: 0x139, region: 0x8a, script: 0x57},
-	21: {lang: 0x41b, region: 0x142, script: 0x57},
-	22: {lang: 0x529, region: 0x53, script: 0x38},
-	23: {lang: 0x4bc, region: 0x137, script: 0x57},
-	24: {lang: 0x3a, region: 0x108, script: 0x5},
-	25: {lang: 0x3e2, region: 0x106, script: 0x1f},
-	26: {lang: 0x3e2, region: 0x106, script: 0x1f},
-	27: {lang: 0x139, region: 0x7b, script: 0x57},
-	28: {lang: 0x10d, region: 0x60, script: 0x57},
-	29: {lang: 0x139, region: 0xd6, script: 0x57},
-	30: {lang: 0x13e, region: 0x1f, script: 0x57},
-	31: {lang: 0x139, region: 0x9a, script: 0x57},
-	32: {lang: 0x139, region: 0x7b, script: 0x57},
-}
-
-// Size: 264 bytes, 33 elements
-var regionContainment = [33]uint64{
-	// Entry 0 - 1F
-	0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008,
-	0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080,
-	0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c,
-	0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000,
-	0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000,
-	0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000,
-	0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000,
-	0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000,
-	// Entry 20 - 3F
-	0x0000000100000000,
-}
-
-// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
-// where each set holds all groupings that are directly connected in a region
-// containment graph.
-// Size: 358 bytes, 358 elements
-var regionInclusion = [358]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
-	0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
-	0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
-	0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e,
-	0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23,
-	0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b,
-	0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d,
-	0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28,
-	// Entry 40 - 7F
-	0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33,
-	0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d,
-	0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23,
-	0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35,
-	0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39,
-	0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f,
-	0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21,
-	0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c,
-	// Entry 80 - BF
-	0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a,
-	0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34,
-	0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24,
-	0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c,
-	0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c,
-	0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31,
-	0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a,
-	0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f,
-	// Entry C0 - FF
-	0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c,
-	0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34,
-	0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21,
-	0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29,
-	0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31,
-	0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21,
-	0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
-	// Entry 100 - 13F
-	0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f,
-	0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a,
-	0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f,
-	0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26,
-	0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d,
-	0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f,
-	0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d,
-	0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b,
-	// Entry 140 - 17F
-	0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f,
-	0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
-}
-
-// regionInclusionBits is an array of bit vectors where every vector represents
-// a set of region groupings.  These sets are used to compute the distance
-// between two regions for the purpose of language matching.
-// Size: 584 bytes, 73 elements
-var regionInclusionBits = [73]uint64{
-	// Entry 0 - 1F
-	0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808,
-	0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082,
-	0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d,
-	0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000,
-	0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010,
-	0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000,
-	0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000,
-	0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010,
-	// Entry 20 - 3F
-	0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000,
-	0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200,
-	0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000,
-	0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080,
-	0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000,
-	0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000,
-	0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000,
-	0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3,
-	// Entry 40 - 5F
-	0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813,
-	0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001,
-	0x0000000102020001,
-}
-
-// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
-// all groups that are reachable from the groups set in the respective entry.
-// Size: 73 bytes, 73 elements
-var regionInclusionNext = [73]uint8{
-	// Entry 0 - 3F
-	0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01,
-	0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16,
-	0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16,
-	0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04,
-	0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09,
-	0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07,
-	0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46,
-	0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e,
-	// Entry 40 - 7F
-	0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43,
-	0x43,
-}
-
-type parentRel struct {
-	lang       uint16
-	script     uint8
-	maxScript  uint8
-	toRegion   uint16
-	fromRegion []uint16
-}
-
-// Size: 414 bytes, 5 elements
-var parents = [5]parentRel{
-	0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}},
-	1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}},
-	2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}},
-	3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}},
-	4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}},
-}
-
-// Total table size 25886 bytes (25KiB); checksum: 50D3D57D
diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go
deleted file mode 100644
index e7afd318..00000000
--- a/vendor/golang.org/x/text/internal/language/tags.go
+++ /dev/null
@@ -1,48 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
-// It simplifies safe initialization of Tag values.
-func MustParse(s string) Tag {
-	t, err := Parse(s)
-	if err != nil {
-		panic(err)
-	}
-	return t
-}
-
-// MustParseBase is like ParseBase, but panics if the given base cannot be parsed.
-// It simplifies safe initialization of Base values.
-func MustParseBase(s string) Language {
-	b, err := ParseBase(s)
-	if err != nil {
-		panic(err)
-	}
-	return b
-}
-
-// MustParseScript is like ParseScript, but panics if the given script cannot be
-// parsed. It simplifies safe initialization of Script values.
-func MustParseScript(s string) Script {
-	scr, err := ParseScript(s)
-	if err != nil {
-		panic(err)
-	}
-	return scr
-}
-
-// MustParseRegion is like ParseRegion, but panics if the given region cannot be
-// parsed. It simplifies safe initialization of Region values.
-func MustParseRegion(s string) Region {
-	r, err := ParseRegion(s)
-	if err != nil {
-		panic(err)
-	}
-	return r
-}
-
-// Und is the root language.
-var Und Tag
diff --git a/vendor/golang.org/x/text/internal/tag/LICENSE b/vendor/golang.org/x/text/internal/tag/LICENSE
deleted file mode 100644
index 6a66aea5..00000000
--- a/vendor/golang.org/x/text/internal/tag/LICENSE
+++ /dev/null
@@ -1,27 +0,0 @@
-Copyright (c) 2009 The Go Authors. All rights reserved.
-
-Redistribution and use in source and binary forms, with or without
-modification, are permitted provided that the following conditions are
-met:
-
-   * Redistributions of source code must retain the above copyright
-notice, this list of conditions and the following disclaimer.
-   * Redistributions in binary form must reproduce the above
-copyright notice, this list of conditions and the following disclaimer
-in the documentation and/or other materials provided with the
-distribution.
-   * Neither the name of Google Inc. nor the names of its
-contributors may be used to endorse or promote products derived from
-this software without specific prior written permission.
-
-THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS
-"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT
-LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR
-A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT
-OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL,
-SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT
-LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE,
-DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY
-THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT
-(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE
-OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go
deleted file mode 100644
index b5d34889..00000000
--- a/vendor/golang.org/x/text/internal/tag/tag.go
+++ /dev/null
@@ -1,100 +0,0 @@
-// Copyright 2015 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package tag contains functionality handling tags and related data.
-package tag // import "golang.org/x/text/internal/tag"
-
-import "sort"
-
-// An Index converts tags to a compact numeric value.
-//
-// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can
-// be used to store additional information about the tag.
-type Index string
-
-// Elem returns the element data at the given index.
-func (s Index) Elem(x int) string {
-	return string(s[x*4 : x*4+4])
-}
-
-// Index reports the index of the given key or -1 if it could not be found.
-// Only the first len(key) bytes from the start of the 4-byte entries will be
-// considered for the search and the first match in Index will be returned.
-func (s Index) Index(key []byte) int {
-	n := len(key)
-	// search the index of the first entry with an equal or higher value than
-	// key in s.
-	index := sort.Search(len(s)/4, func(i int) bool {
-		return cmp(s[i*4:i*4+n], key) != -1
-	})
-	i := index * 4
-	if cmp(s[i:i+len(key)], key) != 0 {
-		return -1
-	}
-	return index
-}
-
-// Next finds the next occurrence of key after index x, which must have been
-// obtained from a call to Index using the same key. It returns x+1 or -1.
-func (s Index) Next(key []byte, x int) int {
-	if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 {
-		return x
-	}
-	return -1
-}
-
-// cmp returns an integer comparing a and b lexicographically.
-func cmp(a Index, b []byte) int {
-	n := len(a)
-	if len(b) < n {
-		n = len(b)
-	}
-	for i, c := range b[:n] {
-		switch {
-		case a[i] > c:
-			return 1
-		case a[i] < c:
-			return -1
-		}
-	}
-	switch {
-	case len(a) < len(b):
-		return -1
-	case len(a) > len(b):
-		return 1
-	}
-	return 0
-}
-
-// Compare returns an integer comparing a and b lexicographically.
-func Compare(a string, b []byte) int {
-	return cmp(Index(a), b)
-}
-
-// FixCase reformats b to the same pattern of cases as form.
-// If returns false if string b is malformed.
-func FixCase(form string, b []byte) bool {
-	if len(form) != len(b) {
-		return false
-	}
-	for i, c := range b {
-		if form[i] <= 'Z' {
-			if c >= 'a' {
-				c -= 'z' - 'Z'
-			}
-			if c < 'A' || 'Z' < c {
-				return false
-			}
-		} else {
-			if c <= 'Z' {
-				c += 'z' - 'Z'
-			}
-			if c < 'a' || 'z' < c {
-				return false
-			}
-		}
-		b[i] = c
-	}
-	return true
-}
diff --git a/vendor/golang.org/x/text/internal/triegen/LICENSE b/vendor/golang.org/x/text/internal/triegen/LICENSE
deleted file mode 100644
index 6a66aea5..00000000
--- a/vendor/golang.org/x/text/internal/triegen/LICENSE
+++ /dev/null
@@ -1,27 +0,0 @@
-Copyright (c) 2009 The Go Authors. All rights reserved.
-
-Redistribution and use in source and binary forms, with or without
-modification, are permitted provided that the following conditions are
-met:
-
-   * Redistributions of source code must retain the above copyright
-notice, this list of conditions and the following disclaimer.
-   * Redistributions in binary form must reproduce the above
-copyright notice, this list of conditions and the following disclaimer
-in the documentation and/or other materials provided with the
-distribution.
-   * Neither the name of Google Inc. nor the names of its
-contributors may be used to endorse or promote products derived from
-this software without specific prior written permission.
-
-THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS
-"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT
-LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR
-A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT
-OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL,
-SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT
-LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE,
-DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY
-THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT
-(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE
-OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
diff --git a/vendor/golang.org/x/text/internal/triegen/compact.go b/vendor/golang.org/x/text/internal/triegen/compact.go
deleted file mode 100644
index 397b975c..00000000
--- a/vendor/golang.org/x/text/internal/triegen/compact.go
+++ /dev/null
@@ -1,58 +0,0 @@
-// Copyright 2014 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package triegen
-
-// This file defines Compacter and its implementations.
-
-import "io"
-
-// A Compacter generates an alternative, more space-efficient way to store a
-// trie value block. A trie value block holds all possible values for the last
-// byte of a UTF-8 encoded rune. Excluding ASCII characters, a trie value block
-// always has 64 values, as a UTF-8 encoding ends with a byte in [0x80, 0xC0).
-type Compacter interface {
-	// Size returns whether the Compacter could encode the given block as well
-	// as its size in case it can. len(v) is always 64.
-	Size(v []uint64) (sz int, ok bool)
-
-	// Store stores the block using the Compacter's compression method.
-	// It returns a handle with which the block can be retrieved.
-	// len(v) is always 64.
-	Store(v []uint64) uint32
-
-	// Print writes the data structures associated to the given store to w.
-	Print(w io.Writer) error
-
-	// Handler returns the name of a function that gets called during trie
-	// lookup for blocks generated by the Compacter. The function should be of
-	// the form func (n uint32, b byte) uint64, where n is the index returned by
-	// the Compacter's Store method and b is the last byte of the UTF-8
-	// encoding, where 0x80 <= b < 0xC0, for which to do the lookup in the
-	// block.
-	Handler() string
-}
-
-// simpleCompacter is the default Compacter used by builder. It implements a
-// normal trie block.
-type simpleCompacter builder
-
-func (b *simpleCompacter) Size([]uint64) (sz int, ok bool) {
-	return blockSize * b.ValueSize, true
-}
-
-func (b *simpleCompacter) Store(v []uint64) uint32 {
-	h := uint32(len(b.ValueBlocks) - blockOffset)
-	b.ValueBlocks = append(b.ValueBlocks, v)
-	return h
-}
-
-func (b *simpleCompacter) Print(io.Writer) error {
-	// Structures are printed in print.go.
-	return nil
-}
-
-func (b *simpleCompacter) Handler() string {
-	panic("Handler should be special-cased for this Compacter")
-}
diff --git a/vendor/golang.org/x/text/internal/triegen/print.go b/vendor/golang.org/x/text/internal/triegen/print.go
deleted file mode 100644
index 8d9f120b..00000000
--- a/vendor/golang.org/x/text/internal/triegen/print.go
+++ /dev/null
@@ -1,251 +0,0 @@
-// Copyright 2014 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package triegen
-
-import (
-	"bytes"
-	"fmt"
-	"io"
-	"strings"
-	"text/template"
-)
-
-// print writes all the data structures as well as the code necessary to use the
-// trie to w.
-func (b *builder) print(w io.Writer) error {
-	b.Stats.NValueEntries = len(b.ValueBlocks) * blockSize
-	b.Stats.NValueBytes = len(b.ValueBlocks) * blockSize * b.ValueSize
-	b.Stats.NIndexEntries = len(b.IndexBlocks) * blockSize
-	b.Stats.NIndexBytes = len(b.IndexBlocks) * blockSize * b.IndexSize
-	b.Stats.NHandleBytes = len(b.Trie) * 2 * b.IndexSize
-
-	// If we only have one root trie, all starter blocks are at position 0 and
-	// we can access the arrays directly.
-	if len(b.Trie) == 1 {
-		// At this point we cannot refer to the generated tables directly.
-		b.ASCIIBlock = b.Name + "Values"
-		b.StarterBlock = b.Name + "Index"
-	} else {
-		// Otherwise we need to have explicit starter indexes in the trie
-		// structure.
-		b.ASCIIBlock = "t.ascii"
-		b.StarterBlock = "t.utf8Start"
-	}
-
-	b.SourceType = "[]byte"
-	if err := lookupGen.Execute(w, b); err != nil {
-		return err
-	}
-
-	b.SourceType = "string"
-	if err := lookupGen.Execute(w, b); err != nil {
-		return err
-	}
-
-	if err := trieGen.Execute(w, b); err != nil {
-		return err
-	}
-
-	for _, c := range b.Compactions {
-		if err := c.c.Print(w); err != nil {
-			return err
-		}
-	}
-
-	return nil
-}
-
-func printValues(n int, values []uint64) string {
-	w := &bytes.Buffer{}
-	boff := n * blockSize
-	fmt.Fprintf(w, "\t// Block %#x, offset %#x", n, boff)
-	var newline bool
-	for i, v := range values {
-		if i%6 == 0 {
-			newline = true
-		}
-		if v != 0 {
-			if newline {
-				fmt.Fprintf(w, "\n")
-				newline = false
-			}
-			fmt.Fprintf(w, "\t%#02x:%#04x, ", boff+i, v)
-		}
-	}
-	return w.String()
-}
-
-func printIndex(b *builder, nr int, n *node) string {
-	w := &bytes.Buffer{}
-	boff := nr * blockSize
-	fmt.Fprintf(w, "\t// Block %#x, offset %#x", nr, boff)
-	var newline bool
-	for i, c := range n.children {
-		if i%8 == 0 {
-			newline = true
-		}
-		if c != nil {
-			v := b.Compactions[c.index.compaction].Offset + uint32(c.index.index)
-			if v != 0 {
-				if newline {
-					fmt.Fprintf(w, "\n")
-					newline = false
-				}
-				fmt.Fprintf(w, "\t%#02x:%#02x, ", boff+i, v)
-			}
-		}
-	}
-	return w.String()
-}
-
-var (
-	trieGen = template.Must(template.New("trie").Funcs(template.FuncMap{
-		"printValues": printValues,
-		"printIndex":  printIndex,
-		"title":       strings.Title,
-		"dec":         func(x int) int { return x - 1 },
-		"psize": func(n int) string {
-			return fmt.Sprintf("%d bytes (%.2f KiB)", n, float64(n)/1024)
-		},
-	}).Parse(trieTemplate))
-	lookupGen = template.Must(template.New("lookup").Parse(lookupTemplate))
-)
-
-// TODO: consider the return type of lookup. It could be uint64, even if the
-// internal value type is smaller. We will have to verify this with the
-// performance of unicode/norm, which is very sensitive to such changes.
-const trieTemplate = `{{$b := .}}{{$multi := gt (len .Trie) 1}}
-// {{.Name}}Trie. Total size: {{psize .Size}}. Checksum: {{printf "%08x" .Checksum}}.
-type {{.Name}}Trie struct { {{if $multi}}
-	ascii []{{.ValueType}} // index for ASCII bytes
-	utf8Start  []{{.IndexType}} // index for UTF-8 bytes >= 0xC0
-{{end}}}
-
-func new{{title .Name}}Trie(i int) *{{.Name}}Trie { {{if $multi}}
-	h := {{.Name}}TrieHandles[i]
-	return &{{.Name}}Trie{ {{.Name}}Values[uint32(h.ascii)<<6:], {{.Name}}Index[uint32(h.multi)<<6:] }
-}
-
-type {{.Name}}TrieHandle struct {
-	ascii, multi {{.IndexType}}
-}
-
-// {{.Name}}TrieHandles: {{len .Trie}} handles, {{.Stats.NHandleBytes}} bytes
-var {{.Name}}TrieHandles = [{{len .Trie}}]{{.Name}}TrieHandle{
-{{range .Trie}}	{ {{.ASCIIIndex}}, {{.StarterIndex}} }, // {{printf "%08x" .Checksum}}: {{.Name}}
-{{end}}}{{else}}
-	return &{{.Name}}Trie{}
-}
-{{end}}
-// lookupValue determines the type of block n and looks up the value for b.
-func (t *{{.Name}}Trie) lookupValue(n uint32, b byte) {{.ValueType}}{{$last := dec (len .Compactions)}} {
-	switch { {{range $i, $c := .Compactions}}
-		{{if eq $i $last}}default{{else}}case n < {{$c.Cutoff}}{{end}}:{{if ne $i 0}}
-			n -= {{$c.Offset}}{{end}}
-			return {{print $b.ValueType}}({{$c.Handler}}){{end}}
-	}
-}
-
-// {{.Name}}Values: {{len .ValueBlocks}} blocks, {{.Stats.NValueEntries}} entries, {{.Stats.NValueBytes}} bytes
-// The third block is the zero block.
-var {{.Name}}Values = [{{.Stats.NValueEntries}}]{{.ValueType}} {
-{{range $i, $v := .ValueBlocks}}{{printValues $i $v}}
-{{end}}}
-
-// {{.Name}}Index: {{len .IndexBlocks}} blocks, {{.Stats.NIndexEntries}} entries, {{.Stats.NIndexBytes}} bytes
-// Block 0 is the zero block.
-var {{.Name}}Index = [{{.Stats.NIndexEntries}}]{{.IndexType}} {
-{{range $i, $v := .IndexBlocks}}{{printIndex $b $i $v}}
-{{end}}}
-`
-
-// TODO: consider allowing zero-length strings after evaluating performance with
-// unicode/norm.
-const lookupTemplate = `
-// lookup{{if eq .SourceType "string"}}String{{end}} returns the trie value for the first UTF-8 encoding in s and
-// the width in bytes of this encoding. The size will be 0 if s does not
-// hold enough bytes to complete the encoding. len(s) must be greater than 0.
-func (t *{{.Name}}Trie) lookup{{if eq .SourceType "string"}}String{{end}}(s {{.SourceType}}) (v {{.ValueType}}, sz int) {
-	c0 := s[0]
-	switch {
-	case c0 < 0x80: // is ASCII
-		return {{.ASCIIBlock}}[c0], 1
-	case c0 < 0xC2:
-		return 0, 1  // Illegal UTF-8: not a starter, not ASCII.
-	case c0 < 0xE0: // 2-byte UTF-8
-		if len(s) < 2 {
-			return 0, 0
-		}
-		i := {{.StarterBlock}}[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c1), 2
-	case c0 < 0xF0: // 3-byte UTF-8
-		if len(s) < 3 {
-			return 0, 0
-		}
-		i := {{.StarterBlock}}[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = {{.Name}}Index[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c2), 3
-	case c0 < 0xF8: // 4-byte UTF-8
-		if len(s) < 4 {
-			return 0, 0
-		}
-		i := {{.StarterBlock}}[c0]
-		c1 := s[1]
-		if c1 < 0x80 || 0xC0 <= c1 {
-			return 0, 1 // Illegal UTF-8: not a continuation byte.
-		}
-		o := uint32(i)<<6 + uint32(c1)
-		i = {{.Name}}Index[o]
-		c2 := s[2]
-		if c2 < 0x80 || 0xC0 <= c2 {
-			return 0, 2 // Illegal UTF-8: not a continuation byte.
-		}
-		o = uint32(i)<<6 + uint32(c2)
-		i = {{.Name}}Index[o]
-		c3 := s[3]
-		if c3 < 0x80 || 0xC0 <= c3 {
-			return 0, 3 // Illegal UTF-8: not a continuation byte.
-		}
-		return t.lookupValue(uint32(i), c3), 4
-	}
-	// Illegal rune
-	return 0, 1
-}
-
-// lookup{{if eq .SourceType "string"}}String{{end}}Unsafe returns the trie value for the first UTF-8 encoding in s.
-// s must start with a full and valid UTF-8 encoded rune.
-func (t *{{.Name}}Trie) lookup{{if eq .SourceType "string"}}String{{end}}Unsafe(s {{.SourceType}}) {{.ValueType}} {
-	c0 := s[0]
-	if c0 < 0x80 { // is ASCII
-		return {{.ASCIIBlock}}[c0]
-	}
-	i := {{.StarterBlock}}[c0]
-	if c0 < 0xE0 { // 2-byte UTF-8
-		return t.lookupValue(uint32(i), s[1])
-	}
-	i = {{.Name}}Index[uint32(i)<<6+uint32(s[1])]
-	if c0 < 0xF0 { // 3-byte UTF-8
-		return t.lookupValue(uint32(i), s[2])
-	}
-	i = {{.Name}}Index[uint32(i)<<6+uint32(s[2])]
-	if c0 < 0xF8 { // 4-byte UTF-8
-		return t.lookupValue(uint32(i), s[3])
-	}
-	return 0
-}
-`
diff --git a/vendor/golang.org/x/text/internal/triegen/triegen.go b/vendor/golang.org/x/text/internal/triegen/triegen.go
deleted file mode 100644
index adb01081..00000000
--- a/vendor/golang.org/x/text/internal/triegen/triegen.go
+++ /dev/null
@@ -1,494 +0,0 @@
-// Copyright 2014 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package triegen implements a code generator for a trie for associating
-// unsigned integer values with UTF-8 encoded runes.
-//
-// Many of the go.text packages use tries for storing per-rune information.  A
-// trie is especially useful if many of the runes have the same value. If this
-// is the case, many blocks can be expected to be shared allowing for
-// information on many runes to be stored in little space.
-//
-// As most of the lookups are done directly on []byte slices, the tries use the
-// UTF-8 bytes directly for the lookup. This saves a conversion from UTF-8 to
-// runes and contributes a little bit to better performance. It also naturally
-// provides a fast path for ASCII.
-//
-// Space is also an issue. There are many code points defined in Unicode and as
-// a result tables can get quite large. So every byte counts. The triegen
-// package automatically chooses the smallest integer values to represent the
-// tables. Compacters allow further compression of the trie by allowing for
-// alternative representations of individual trie blocks.
-//
-// triegen allows generating multiple tries as a single structure. This is
-// useful when, for example, one wants to generate tries for several languages
-// that have a lot of values in common. Some existing libraries for
-// internationalization store all per-language data as a dynamically loadable
-// chunk. The go.text packages are designed with the assumption that the user
-// typically wants to compile in support for all supported languages, in line
-// with the approach common to Go to create a single standalone binary. The
-// multi-root trie approach can give significant storage savings in this
-// scenario.
-//
-// triegen generates both tables and code. The code is optimized to use the
-// automatically chosen data types. The following code is generated for a Trie
-// or multiple Tries named "foo":
-//	- type fooTrie
-//		The trie type.
-//
-//	- func newFooTrie(x int) *fooTrie
-//		Trie constructor, where x is the index of the trie passed to Gen.
-//
-//	- func (t *fooTrie) lookup(s []byte) (v uintX, sz int)
-//		The lookup method, where uintX is automatically chosen.
-//
-//	- func lookupString, lookupUnsafe and lookupStringUnsafe
-//		Variants of the above.
-//
-//	- var fooValues and fooIndex and any tables generated by Compacters.
-//		The core trie data.
-//
-//	- var fooTrieHandles
-//		Indexes of starter blocks in case of multiple trie roots.
-//
-// It is recommended that users test the generated trie by checking the returned
-// value for every rune. Such exhaustive tests are possible as the the number of
-// runes in Unicode is limited.
-package triegen // import "golang.org/x/text/internal/triegen"
-
-// TODO: Arguably, the internally optimized data types would not have to be
-// exposed in the generated API. We could also investigate not generating the
-// code, but using it through a package. We would have to investigate the impact
-// on performance of making such change, though. For packages like unicode/norm,
-// small changes like this could tank performance.
-
-import (
-	"encoding/binary"
-	"fmt"
-	"hash/crc64"
-	"io"
-	"log"
-	"unicode/utf8"
-)
-
-// builder builds a set of tries for associating values with runes. The set of
-// tries can share common index and value blocks.
-type builder struct {
-	Name string
-
-	// ValueType is the type of the trie values looked up.
-	ValueType string
-
-	// ValueSize is the byte size of the ValueType.
-	ValueSize int
-
-	// IndexType is the type of trie index values used for all UTF-8 bytes of
-	// a rune except the last one.
-	IndexType string
-
-	// IndexSize is the byte size of the IndexType.
-	IndexSize int
-
-	// SourceType is used when generating the lookup functions. If the user
-	// requests StringSupport, all lookup functions will be generated for
-	// string input as well.
-	SourceType string
-
-	Trie []*Trie
-
-	IndexBlocks []*node
-	ValueBlocks [][]uint64
-	Compactions []compaction
-	Checksum    uint64
-
-	ASCIIBlock   string
-	StarterBlock string
-
-	indexBlockIdx map[uint64]int
-	valueBlockIdx map[uint64]nodeIndex
-	asciiBlockIdx map[uint64]int
-
-	// Stats are used to fill out the template.
-	Stats struct {
-		NValueEntries int
-		NValueBytes   int
-		NIndexEntries int
-		NIndexBytes   int
-		NHandleBytes  int
-	}
-
-	err error
-}
-
-// A nodeIndex encodes the index of a node, which is defined by the compaction
-// which stores it and an index within the compaction. For internal nodes, the
-// compaction is always 0.
-type nodeIndex struct {
-	compaction int
-	index      int
-}
-
-// compaction keeps track of stats used for the compaction.
-type compaction struct {
-	c         Compacter
-	blocks    []*node
-	maxHandle uint32
-	totalSize int
-
-	// Used by template-based generator and thus exported.
-	Cutoff  uint32
-	Offset  uint32
-	Handler string
-}
-
-func (b *builder) setError(err error) {
-	if b.err == nil {
-		b.err = err
-	}
-}
-
-// An Option can be passed to Gen.
-type Option func(b *builder) error
-
-// Compact configures the trie generator to use the given Compacter.
-func Compact(c Compacter) Option {
-	return func(b *builder) error {
-		b.Compactions = append(b.Compactions, compaction{
-			c:       c,
-			Handler: c.Handler() + "(n, b)"})
-		return nil
-	}
-}
-
-// Gen writes Go code for a shared trie lookup structure to w for the given
-// Tries. The generated trie type will be called nameTrie. newNameTrie(x) will
-// return the *nameTrie for tries[x]. A value can be looked up by using one of
-// the various lookup methods defined on nameTrie. It returns the table size of
-// the generated trie.
-func Gen(w io.Writer, name string, tries []*Trie, opts ...Option) (sz int, err error) {
-	// The index contains two dummy blocks, followed by the zero block. The zero
-	// block is at offset 0x80, so that the offset for the zero block for
-	// continuation bytes is 0.
-	b := &builder{
-		Name:        name,
-		Trie:        tries,
-		IndexBlocks: []*node{{}, {}, {}},
-		Compactions: []compaction{{
-			Handler: name + "Values[n<<6+uint32(b)]",
-		}},
-		// The 0 key in indexBlockIdx and valueBlockIdx is the hash of the zero
-		// block.
-		indexBlockIdx: map[uint64]int{0: 0},
-		valueBlockIdx: map[uint64]nodeIndex{0: {}},
-		asciiBlockIdx: map[uint64]int{},
-	}
-	b.Compactions[0].c = (*simpleCompacter)(b)
-
-	for _, f := range opts {
-		if err := f(b); err != nil {
-			return 0, err
-		}
-	}
-	b.build()
-	if b.err != nil {
-		return 0, b.err
-	}
-	if err = b.print(w); err != nil {
-		return 0, err
-	}
-	return b.Size(), nil
-}
-
-// A Trie represents a single root node of a trie. A builder may build several
-// overlapping tries at once.
-type Trie struct {
-	root *node
-
-	hiddenTrie
-}
-
-// hiddenTrie contains values we want to be visible to the template generator,
-// but hidden from the API documentation.
-type hiddenTrie struct {
-	Name         string
-	Checksum     uint64
-	ASCIIIndex   int
-	StarterIndex int
-}
-
-// NewTrie returns a new trie root.
-func NewTrie(name string) *Trie {
-	return &Trie{
-		&node{
-			children: make([]*node, blockSize),
-			values:   make([]uint64, utf8.RuneSelf),
-		},
-		hiddenTrie{Name: name},
-	}
-}
-
-// Gen is a convenience wrapper around the Gen func passing t as the only trie
-// and uses the name passed to NewTrie. It returns the size of the generated
-// tables.
-func (t *Trie) Gen(w io.Writer, opts ...Option) (sz int, err error) {
-	return Gen(w, t.Name, []*Trie{t}, opts...)
-}
-
-// node is a node of the intermediate trie structure.
-type node struct {
-	// children holds this node's children. It is always of length 64.
-	// A child node may be nil.
-	children []*node
-
-	// values contains the values of this node. If it is non-nil, this node is
-	// either a root or leaf node:
-	// For root nodes, len(values) == 128 and it maps the bytes in [0x00, 0x7F].
-	// For leaf nodes, len(values) ==  64 and it maps the bytes in [0x80, 0xBF].
-	values []uint64
-
-	index nodeIndex
-}
-
-// Insert associates value with the given rune. Insert will panic if a non-zero
-// value is passed for an invalid rune.
-func (t *Trie) Insert(r rune, value uint64) {
-	if value == 0 {
-		return
-	}
-	s := string(r)
-	if []rune(s)[0] != r && value != 0 {
-		// Note: The UCD tables will always assign what amounts to a zero value
-		// to a surrogate. Allowing a zero value for an illegal rune allows
-		// users to iterate over [0..MaxRune] without having to explicitly
-		// exclude surrogates, which would be tedious.
-		panic(fmt.Sprintf("triegen: non-zero value for invalid rune %U", r))
-	}
-	if len(s) == 1 {
-		// It is a root node value (ASCII).
-		t.root.values[s[0]] = value
-		return
-	}
-
-	n := t.root
-	for ; len(s) > 1; s = s[1:] {
-		if n.children == nil {
-			n.children = make([]*node, blockSize)
-		}
-		p := s[0] % blockSize
-		c := n.children[p]
-		if c == nil {
-			c = &node{}
-			n.children[p] = c
-		}
-		if len(s) > 2 && c.values != nil {
-			log.Fatalf("triegen: insert(%U): found internal node with values", r)
-		}
-		n = c
-	}
-	if n.values == nil {
-		n.values = make([]uint64, blockSize)
-	}
-	if n.children != nil {
-		log.Fatalf("triegen: insert(%U): found leaf node that also has child nodes", r)
-	}
-	n.values[s[0]-0x80] = value
-}
-
-// Size returns the number of bytes the generated trie will take to store. It
-// needs to be exported as it is used in the templates.
-func (b *builder) Size() int {
-	// Index blocks.
-	sz := len(b.IndexBlocks) * blockSize * b.IndexSize
-
-	// Skip the first compaction, which represents the normal value blocks, as
-	// its totalSize does not account for the ASCII blocks, which are managed
-	// separately.
-	sz += len(b.ValueBlocks) * blockSize * b.ValueSize
-	for _, c := range b.Compactions[1:] {
-		sz += c.totalSize
-	}
-
-	// TODO: this computation does not account for the fixed overhead of a using
-	// a compaction, either code or data. As for data, though, the typical
-	// overhead of data is in the order of bytes (2 bytes for cases). Further,
-	// the savings of using a compaction should anyway be substantial for it to
-	// be worth it.
-
-	// For multi-root tries, we also need to account for the handles.
-	if len(b.Trie) > 1 {
-		sz += 2 * b.IndexSize * len(b.Trie)
-	}
-	return sz
-}
-
-func (b *builder) build() {
-	// Compute the sizes of the values.
-	var vmax uint64
-	for _, t := range b.Trie {
-		vmax = maxValue(t.root, vmax)
-	}
-	b.ValueType, b.ValueSize = getIntType(vmax)
-
-	// Compute all block allocations.
-	// TODO: first compute the ASCII blocks for all tries and then the other
-	// nodes. ASCII blocks are more restricted in placement, as they require two
-	// blocks to be placed consecutively. Processing them first may improve
-	// sharing (at least one zero block can be expected to be saved.)
-	for _, t := range b.Trie {
-		b.Checksum += b.buildTrie(t)
-	}
-
-	// Compute the offsets for all the Compacters.
-	offset := uint32(0)
-	for i := range b.Compactions {
-		c := &b.Compactions[i]
-		c.Offset = offset
-		offset += c.maxHandle + 1
-		c.Cutoff = offset
-	}
-
-	// Compute the sizes of indexes.
-	// TODO: different byte positions could have different sizes. So far we have
-	// not found a case where this is beneficial.
-	imax := uint64(b.Compactions[len(b.Compactions)-1].Cutoff)
-	for _, ib := range b.IndexBlocks {
-		if x := uint64(ib.index.index); x > imax {
-			imax = x
-		}
-	}
-	b.IndexType, b.IndexSize = getIntType(imax)
-}
-
-func maxValue(n *node, max uint64) uint64 {
-	if n == nil {
-		return max
-	}
-	for _, c := range n.children {
-		max = maxValue(c, max)
-	}
-	for _, v := range n.values {
-		if max < v {
-			max = v
-		}
-	}
-	return max
-}
-
-func getIntType(v uint64) (string, int) {
-	switch {
-	case v < 1<<8:
-		return "uint8", 1
-	case v < 1<<16:
-		return "uint16", 2
-	case v < 1<<32:
-		return "uint32", 4
-	}
-	return "uint64", 8
-}
-
-const (
-	blockSize = 64
-
-	// Subtract two blocks to offset 0x80, the first continuation byte.
-	blockOffset = 2
-
-	// Subtract three blocks to offset 0xC0, the first non-ASCII starter.
-	rootBlockOffset = 3
-)
-
-var crcTable = crc64.MakeTable(crc64.ISO)
-
-func (b *builder) buildTrie(t *Trie) uint64 {
-	n := t.root
-
-	// Get the ASCII offset. For the first trie, the ASCII block will be at
-	// position 0.
-	hasher := crc64.New(crcTable)
-	binary.Write(hasher, binary.BigEndian, n.values)
-	hash := hasher.Sum64()
-
-	v, ok := b.asciiBlockIdx[hash]
-	if !ok {
-		v = len(b.ValueBlocks)
-		b.asciiBlockIdx[hash] = v
-
-		b.ValueBlocks = append(b.ValueBlocks, n.values[:blockSize], n.values[blockSize:])
-		if v == 0 {
-			// Add the zero block at position 2 so that it will be assigned a
-			// zero reference in the lookup blocks.
-			// TODO: always do this? This would allow us to remove a check from
-			// the trie lookup, but at the expense of extra space. Analyze
-			// performance for unicode/norm.
-			b.ValueBlocks = append(b.ValueBlocks, make([]uint64, blockSize))
-		}
-	}
-	t.ASCIIIndex = v
-
-	// Compute remaining offsets.
-	t.Checksum = b.computeOffsets(n, true)
-	// We already subtracted the normal blockOffset from the index. Subtract the
-	// difference for starter bytes.
-	t.StarterIndex = n.index.index - (rootBlockOffset - blockOffset)
-	return t.Checksum
-}
-
-func (b *builder) computeOffsets(n *node, root bool) uint64 {
-	// For the first trie, the root lookup block will be at position 3, which is
-	// the offset for UTF-8 non-ASCII starter bytes.
-	first := len(b.IndexBlocks) == rootBlockOffset
-	if first {
-		b.IndexBlocks = append(b.IndexBlocks, n)
-	}
-
-	// We special-case the cases where all values recursively are 0. This allows
-	// for the use of a zero block to which all such values can be directed.
-	hash := uint64(0)
-	if n.children != nil || n.values != nil {
-		hasher := crc64.New(crcTable)
-		for _, c := range n.children {
-			var v uint64
-			if c != nil {
-				v = b.computeOffsets(c, false)
-			}
-			binary.Write(hasher, binary.BigEndian, v)
-		}
-		binary.Write(hasher, binary.BigEndian, n.values)
-		hash = hasher.Sum64()
-	}
-
-	if first {
-		b.indexBlockIdx[hash] = rootBlockOffset - blockOffset
-	}
-
-	// Compacters don't apply to internal nodes.
-	if n.children != nil {
-		v, ok := b.indexBlockIdx[hash]
-		if !ok {
-			v = len(b.IndexBlocks) - blockOffset
-			b.IndexBlocks = append(b.IndexBlocks, n)
-			b.indexBlockIdx[hash] = v
-		}
-		n.index = nodeIndex{0, v}
-	} else {
-		h, ok := b.valueBlockIdx[hash]
-		if !ok {
-			bestI, bestSize := 0, blockSize*b.ValueSize
-			for i, c := range b.Compactions[1:] {
-				if sz, ok := c.c.Size(n.values); ok && bestSize > sz {
-					bestI, bestSize = i+1, sz
-				}
-			}
-			c := &b.Compactions[bestI]
-			c.totalSize += bestSize
-			v := c.c.Store(n.values)
-			if c.maxHandle < v {
-				c.maxHandle = v
-			}
-			h = nodeIndex{bestI, int(v)}
-			b.valueBlockIdx[hash] = h
-		}
-		n.index = h
-	}
-	return hash
-}
diff --git a/vendor/golang.org/x/text/internal/ucd/LICENSE b/vendor/golang.org/x/text/internal/ucd/LICENSE
deleted file mode 100644
index 6a66aea5..00000000
--- a/vendor/golang.org/x/text/internal/ucd/LICENSE
+++ /dev/null
@@ -1,27 +0,0 @@
-Copyright (c) 2009 The Go Authors. All rights reserved.
-
-Redistribution and use in source and binary forms, with or without
-modification, are permitted provided that the following conditions are
-met:
-
-   * Redistributions of source code must retain the above copyright
-notice, this list of conditions and the following disclaimer.
-   * Redistributions in binary form must reproduce the above
-copyright notice, this list of conditions and the following disclaimer
-in the documentation and/or other materials provided with the
-distribution.
-   * Neither the name of Google Inc. nor the names of its
-contributors may be used to endorse or promote products derived from
-this software without specific prior written permission.
-
-THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS
-"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT
-LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR
-A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT
-OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL,
-SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT
-LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE,
-DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY
-THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT
-(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE
-OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
diff --git a/vendor/golang.org/x/text/internal/ucd/ucd.go b/vendor/golang.org/x/text/internal/ucd/ucd.go
deleted file mode 100644
index 8c45b5f3..00000000
--- a/vendor/golang.org/x/text/internal/ucd/ucd.go
+++ /dev/null
@@ -1,371 +0,0 @@
-// Copyright 2014 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package ucd provides a parser for Unicode Character Database files, the
-// format of which is defined in http://www.unicode.org/reports/tr44/. See
-// http://www.unicode.org/Public/UCD/latest/ucd/ for example files.
-//
-// It currently does not support substitutions of missing fields.
-package ucd // import "golang.org/x/text/internal/ucd"
-
-import (
-	"bufio"
-	"errors"
-	"fmt"
-	"io"
-	"log"
-	"regexp"
-	"strconv"
-	"strings"
-)
-
-// UnicodeData.txt fields.
-const (
-	CodePoint = iota
-	Name
-	GeneralCategory
-	CanonicalCombiningClass
-	BidiClass
-	DecompMapping
-	DecimalValue
-	DigitValue
-	NumericValue
-	BidiMirrored
-	Unicode1Name
-	ISOComment
-	SimpleUppercaseMapping
-	SimpleLowercaseMapping
-	SimpleTitlecaseMapping
-)
-
-// Parse calls f for each entry in the given reader of a UCD file. It will close
-// the reader upon return. It will call log.Fatal if any error occurred.
-//
-// This implements the most common usage pattern of using Parser.
-func Parse(r io.ReadCloser, f func(p *Parser)) {
-	defer r.Close()
-
-	p := New(r)
-	for p.Next() {
-		f(p)
-	}
-	if err := p.Err(); err != nil {
-		r.Close() // os.Exit will cause defers not to be called.
-		log.Fatal(err)
-	}
-}
-
-// An Option is used to configure a Parser.
-type Option func(p *Parser)
-
-func keepRanges(p *Parser) {
-	p.keepRanges = true
-}
-
-var (
-	// KeepRanges prevents the expansion of ranges. The raw ranges can be
-	// obtained by calling Range(0) on the parser.
-	KeepRanges Option = keepRanges
-)
-
-// The Part option register a handler for lines starting with a '@'. The text
-// after a '@' is available as the first field. Comments are handled as usual.
-func Part(f func(p *Parser)) Option {
-	return func(p *Parser) {
-		p.partHandler = f
-	}
-}
-
-// The CommentHandler option passes comments that are on a line by itself to
-// a given handler.
-func CommentHandler(f func(s string)) Option {
-	return func(p *Parser) {
-		p.commentHandler = f
-	}
-}
-
-// A Parser parses Unicode Character Database (UCD) files.
-type Parser struct {
-	scanner *bufio.Scanner
-
-	keepRanges bool // Don't expand rune ranges in field 0.
-
-	err     error
-	comment string
-	field   []string
-	// parsedRange is needed in case Range(0) is called more than once for one
-	// field. In some cases this requires scanning ahead.
-	line                 int
-	parsedRange          bool
-	rangeStart, rangeEnd rune
-
-	partHandler    func(p *Parser)
-	commentHandler func(s string)
-}
-
-func (p *Parser) setError(err error, msg string) {
-	if p.err == nil && err != nil {
-		if msg == "" {
-			p.err = fmt.Errorf("ucd:line:%d: %v", p.line, err)
-		} else {
-			p.err = fmt.Errorf("ucd:line:%d:%s: %v", p.line, msg, err)
-		}
-	}
-}
-
-func (p *Parser) getField(i int) string {
-	if i >= len(p.field) {
-		return ""
-	}
-	return p.field[i]
-}
-
-// Err returns a non-nil error if any error occurred during parsing.
-func (p *Parser) Err() error {
-	return p.err
-}
-
-// New returns a Parser for the given Reader.
-func New(r io.Reader, o ...Option) *Parser {
-	p := &Parser{
-		scanner: bufio.NewScanner(r),
-	}
-	for _, f := range o {
-		f(p)
-	}
-	return p
-}
-
-// Next parses the next line in the file. It returns true if a line was parsed
-// and false if it reached the end of the file.
-func (p *Parser) Next() bool {
-	if !p.keepRanges && p.rangeStart < p.rangeEnd {
-		p.rangeStart++
-		return true
-	}
-	p.comment = ""
-	p.field = p.field[:0]
-	p.parsedRange = false
-
-	for p.scanner.Scan() && p.err == nil {
-		p.line++
-		s := p.scanner.Text()
-		if s == "" {
-			continue
-		}
-		if s[0] == '#' {
-			if p.commentHandler != nil {
-				p.commentHandler(strings.TrimSpace(s[1:]))
-			}
-			continue
-		}
-
-		// Parse line
-		if i := strings.IndexByte(s, '#'); i != -1 {
-			p.comment = strings.TrimSpace(s[i+1:])
-			s = s[:i]
-		}
-		if s[0] == '@' {
-			if p.partHandler != nil {
-				p.field = append(p.field, strings.TrimSpace(s[1:]))
-				p.partHandler(p)
-				p.field = p.field[:0]
-			}
-			p.comment = ""
-			continue
-		}
-		for {
-			i := strings.IndexByte(s, ';')
-			if i == -1 {
-				p.field = append(p.field, strings.TrimSpace(s))
-				break
-			}
-			p.field = append(p.field, strings.TrimSpace(s[:i]))
-			s = s[i+1:]
-		}
-		if !p.keepRanges {
-			p.rangeStart, p.rangeEnd = p.getRange(0)
-		}
-		return true
-	}
-	p.setError(p.scanner.Err(), "scanner failed")
-	return false
-}
-
-func parseRune(b string) (rune, error) {
-	if len(b) > 2 && b[0] == 'U' && b[1] == '+' {
-		b = b[2:]
-	}
-	x, err := strconv.ParseUint(b, 16, 32)
-	return rune(x), err
-}
-
-func (p *Parser) parseRune(s string) rune {
-	x, err := parseRune(s)
-	p.setError(err, "failed to parse rune")
-	return x
-}
-
-// Rune parses and returns field i as a rune.
-func (p *Parser) Rune(i int) rune {
-	if i > 0 || p.keepRanges {
-		return p.parseRune(p.getField(i))
-	}
-	return p.rangeStart
-}
-
-// Runes interprets and returns field i as a sequence of runes.
-func (p *Parser) Runes(i int) (runes []rune) {
-	add := func(s string) {
-		if s = strings.TrimSpace(s); len(s) > 0 {
-			runes = append(runes, p.parseRune(s))
-		}
-	}
-	for b := p.getField(i); ; {
-		i := strings.IndexByte(b, ' ')
-		if i == -1 {
-			add(b)
-			break
-		}
-		add(b[:i])
-		b = b[i+1:]
-	}
-	return
-}
-
-var (
-	errIncorrectLegacyRange = errors.New("ucd: unmatched <* First>")
-
-	// reRange matches one line of a legacy rune range.
-	reRange = regexp.MustCompile("^([0-9A-F]*);<([^,]*), ([^>]*)>(.*)$")
-)
-
-// Range parses and returns field i as a rune range. A range is inclusive at
-// both ends. If the field only has one rune, first and last will be identical.
-// It supports the legacy format for ranges used in UnicodeData.txt.
-func (p *Parser) Range(i int) (first, last rune) {
-	if !p.keepRanges {
-		return p.rangeStart, p.rangeStart
-	}
-	return p.getRange(i)
-}
-
-func (p *Parser) getRange(i int) (first, last rune) {
-	b := p.getField(i)
-	if k := strings.Index(b, ".."); k != -1 {
-		return p.parseRune(b[:k]), p.parseRune(b[k+2:])
-	}
-	// The first field may not be a rune, in which case we may ignore any error
-	// and set the range as 0..0.
-	x, err := parseRune(b)
-	if err != nil {
-		// Disable range parsing henceforth. This ensures that an error will be
-		// returned if the user subsequently will try to parse this field as
-		// a Rune.
-		p.keepRanges = true
-	}
-	// Special case for UnicodeData that was retained for backwards compatibility.
-	if i == 0 && len(p.field) > 1 && strings.HasSuffix(p.field[1], "First>") {
-		if p.parsedRange {
-			return p.rangeStart, p.rangeEnd
-		}
-		mf := reRange.FindStringSubmatch(p.scanner.Text())
-		p.line++
-		if mf == nil || !p.scanner.Scan() {
-			p.setError(errIncorrectLegacyRange, "")
-			return x, x
-		}
-		// Using Bytes would be more efficient here, but Text is a lot easier
-		// and this is not a frequent case.
-		ml := reRange.FindStringSubmatch(p.scanner.Text())
-		if ml == nil || mf[2] != ml[2] || ml[3] != "Last" || mf[4] != ml[4] {
-			p.setError(errIncorrectLegacyRange, "")
-			return x, x
-		}
-		p.rangeStart, p.rangeEnd = x, p.parseRune(p.scanner.Text()[:len(ml[1])])
-		p.parsedRange = true
-		return p.rangeStart, p.rangeEnd
-	}
-	return x, x
-}
-
-// bools recognizes all valid UCD boolean values.
-var bools = map[string]bool{
-	"":      false,
-	"N":     false,
-	"No":    false,
-	"F":     false,
-	"False": false,
-	"Y":     true,
-	"Yes":   true,
-	"T":     true,
-	"True":  true,
-}
-
-// Bool parses and returns field i as a boolean value.
-func (p *Parser) Bool(i int) bool {
-	f := p.getField(i)
-	for s, v := range bools {
-		if f == s {
-			return v
-		}
-	}
-	p.setError(strconv.ErrSyntax, "error parsing bool")
-	return false
-}
-
-// Int parses and returns field i as an integer value.
-func (p *Parser) Int(i int) int {
-	x, err := strconv.ParseInt(string(p.getField(i)), 10, 64)
-	p.setError(err, "error parsing int")
-	return int(x)
-}
-
-// Uint parses and returns field i as an unsigned integer value.
-func (p *Parser) Uint(i int) uint {
-	x, err := strconv.ParseUint(string(p.getField(i)), 10, 64)
-	p.setError(err, "error parsing uint")
-	return uint(x)
-}
-
-// Float parses and returns field i as a decimal value.
-func (p *Parser) Float(i int) float64 {
-	x, err := strconv.ParseFloat(string(p.getField(i)), 64)
-	p.setError(err, "error parsing float")
-	return x
-}
-
-// String parses and returns field i as a string value.
-func (p *Parser) String(i int) string {
-	return string(p.getField(i))
-}
-
-// Strings parses and returns field i as a space-separated list of strings.
-func (p *Parser) Strings(i int) []string {
-	ss := strings.Split(string(p.getField(i)), " ")
-	for i, s := range ss {
-		ss[i] = strings.TrimSpace(s)
-	}
-	return ss
-}
-
-// Comment returns the comments for the current line.
-func (p *Parser) Comment() string {
-	return string(p.comment)
-}
-
-var errUndefinedEnum = errors.New("ucd: undefined enum value")
-
-// Enum interprets and returns field i as a value that must be one of the values
-// in enum.
-func (p *Parser) Enum(i int, enum ...string) string {
-	f := p.getField(i)
-	for _, s := range enum {
-		if f == s {
-			return s
-		}
-	}
-	p.setError(errUndefinedEnum, "error parsing enum")
-	return ""
-}
diff --git a/vendor/golang.org/x/text/internal/utf8internal/LICENSE b/vendor/golang.org/x/text/internal/utf8internal/LICENSE
deleted file mode 100644
index 6a66aea5..00000000
--- a/vendor/golang.org/x/text/internal/utf8internal/LICENSE
+++ /dev/null
@@ -1,27 +0,0 @@
-Copyright (c) 2009 The Go Authors. All rights reserved.
-
-Redistribution and use in source and binary forms, with or without
-modification, are permitted provided that the following conditions are
-met:
-
-   * Redistributions of source code must retain the above copyright
-notice, this list of conditions and the following disclaimer.
-   * Redistributions in binary form must reproduce the above
-copyright notice, this list of conditions and the following disclaimer
-in the documentation and/or other materials provided with the
-distribution.
-   * Neither the name of Google Inc. nor the names of its
-contributors may be used to endorse or promote products derived from
-this software without specific prior written permission.
-
-THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS
-"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT
-LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR
-A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT
-OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL,
-SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT
-LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE,
-DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY
-THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT
-(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE
-OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
diff --git a/vendor/golang.org/x/text/internal/utf8internal/utf8internal.go b/vendor/golang.org/x/text/internal/utf8internal/utf8internal.go
deleted file mode 100644
index 575cea87..00000000
--- a/vendor/golang.org/x/text/internal/utf8internal/utf8internal.go
+++ /dev/null
@@ -1,87 +0,0 @@
-// Copyright 2015 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package utf8internal contains low-level utf8-related constants, tables, etc.
-// that are used internally by the text package.
-package utf8internal
-
-// The default lowest and highest continuation byte.
-const (
-	LoCB = 0x80 // 1000 0000
-	HiCB = 0xBF // 1011 1111
-)
-
-// Constants related to getting information of first bytes of UTF-8 sequences.
-const (
-	// ASCII identifies a UTF-8 byte as ASCII.
-	ASCII = as
-
-	// FirstInvalid indicates a byte is invalid as a first byte of a UTF-8
-	// sequence.
-	FirstInvalid = xx
-
-	// SizeMask is a mask for the size bits. Use use x&SizeMask to get the size.
-	SizeMask = 7
-
-	// AcceptShift is the right-shift count for the first byte info byte to get
-	// the index into the AcceptRanges table. See AcceptRanges.
-	AcceptShift = 4
-
-	// The names of these constants are chosen to give nice alignment in the
-	// table below. The first nibble is an index into acceptRanges or F for
-	// special one-byte cases. The second nibble is the Rune length or the
-	// Status for the special one-byte case.
-	xx = 0xF1 // invalid: size 1
-	as = 0xF0 // ASCII: size 1
-	s1 = 0x02 // accept 0, size 2
-	s2 = 0x13 // accept 1, size 3
-	s3 = 0x03 // accept 0, size 3
-	s4 = 0x23 // accept 2, size 3
-	s5 = 0x34 // accept 3, size 4
-	s6 = 0x04 // accept 0, size 4
-	s7 = 0x44 // accept 4, size 4
-)
-
-// First is information about the first byte in a UTF-8 sequence.
-var First = [256]uint8{
-	//   1   2   3   4   5   6   7   8   9   A   B   C   D   E   F
-	as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x00-0x0F
-	as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x10-0x1F
-	as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x20-0x2F
-	as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x30-0x3F
-	as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x40-0x4F
-	as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x50-0x5F
-	as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x60-0x6F
-	as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, as, // 0x70-0x7F
-	//   1   2   3   4   5   6   7   8   9   A   B   C   D   E   F
-	xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, // 0x80-0x8F
-	xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, // 0x90-0x9F
-	xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, // 0xA0-0xAF
-	xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, // 0xB0-0xBF
-	xx, xx, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, // 0xC0-0xCF
-	s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, s1, // 0xD0-0xDF
-	s2, s3, s3, s3, s3, s3, s3, s3, s3, s3, s3, s3, s3, s4, s3, s3, // 0xE0-0xEF
-	s5, s6, s6, s6, s7, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, xx, // 0xF0-0xFF
-}
-
-// AcceptRange gives the range of valid values for the second byte in a UTF-8
-// sequence for any value for First that is not ASCII or FirstInvalid.
-type AcceptRange struct {
-	Lo uint8 // lowest value for second byte.
-	Hi uint8 // highest value for second byte.
-}
-
-// AcceptRanges is a slice of AcceptRange values. For a given byte sequence b
-//
-//		AcceptRanges[First[b[0]]>>AcceptShift]
-//
-// will give the value of AcceptRange for the multi-byte UTF-8 sequence starting
-// at b[0].
-var AcceptRanges = [...]AcceptRange{
-	0: {LoCB, HiCB},
-	1: {0xA0, HiCB},
-	2: {LoCB, 0x9F},
-	3: {0x90, HiCB},
-	4: {LoCB, 0x8F},
-}